PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID POO02625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 939aa    MW: 99887 Da    PI: 7.3119
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
POO02625.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.4e-096506871954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  POO02625.1 650 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 687
                 664459******************************88 PP

2BELL121.34.1e-39510581172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +r e q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  POO02625.1 510 DRIEQQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAISAQL 581
                 5889*****************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    
MGITTPPIIF SNSKVLHNYS IISSSEKPSH NNNSNSNNNN NKNKNCSSNS MSQDYHHQAP  60
AAGIFSTNTF SNGFERSSVA AASHQDHHQH HIAQQIRRDK LRVQAGFEAA PPPLVGIDED  120
ESGALPVYES AGMLSEMFNF PQGHAAAAEL LDQQQQQQQA MAPPSYRSPR PQQPPHQGGV  180
GNEWYGGRQG MVIVGGGSLA SSLGDNSNSN HNPKNQTSSR DSIAHHHHQQ QQQHHQISSI  240
NADSAAAMQL FLMNPQPRSP SPPPPSAVAA SNSSSTLHML LPNPSTSSLV QAFTPSGTPG  300
GGAFGQFTWI PDTTHEGGGP TNEIGGVPHH HHVAEGQGLS LTLSSSLQPL EASAKAAEEL  360
RMGNTALLYY GGGSSGPEHY PYKNYGAGTT SQVQAQALHL QTGGGGGGVL VGPNQHHHHQ  420
VHVGFGSSLG VVNVLRNSKY VKAAQELLEE FCSVGRGHFK KNKFGTSTRQ NTTNPSANPG  480
TSSGGGGGGG GGGSSSSSKD GVNPPLSAAD RIEQQRRKVK LLSMLDEVDR RYNHYCEQMQ  540
MVVNSFDLVM GFGAAVPYTA LAQKAMSRHF RCLKDAISAQ LKHSCELLGE KDGAGTSGIT  600
KGETPRLKIL EQSLRQQRAF QSIGMMEQEA WRPQRGLPER SVNILRAWLF EHFLHPYPSD  660
ADKHLLARQT GLSRNQVSNW FINARVRLWK PMVEEMYQQE TKEEETLSSD QERSTDHHDH  720
HQMIIRSSRN IINNQNSSTS SGVGGGGHGL LAQTPTPNSS TTAATQATTT PTPQTTTTTT  780
TTTAAAAAAA ARRSDINAIE SDPSLVAISN NNTSIRQPFS ENQAMMKQAH QAIATSSTPS  840
STSELVAPPV SQSYAAAGDD TCLRGGLVAA AEFGTTTTAS GSNINIAAPH PDHHGGGALI  900
AFGTTTTTAG DVSLTLGLRH AGDMPENTPS PFSVRDFGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-141TALE family protein