PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID POO01357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 668aa    MW: 72690.6 Da    PI: 8.4905
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
POO01357.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-094234601954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+++++  LAk++gLt +qV++WF N R +
  POO01357.1 423 FEHflHPYPKTADKVMLAKQTGLTRSQVSNWFINARVR 460
                 554459******************************88 PP

2BELL111.93.5e-36285356172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +rqelq kkakL s+l+eV++rY+qy++q++ vi sFe++ag gs+k+Yt+lAlk+iS++FrcLkdai+ qi
  POO01357.1 285 QRQELQVKKAKLASMLDEVEQRYRQYHQQMHNVIISFEQAAGFGSSKSYTALALKTISKQFRCLKDAISAQI 356
                 69********************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    
MATYFHHGSS EIQAPDGLHT LYLMNPNNYL QTFSDHHTTT QPAAPNMFLL NPSAAAASVS  60
HFQPHPSRHL AGIPVPSSAA AGGSSNSSDH DEISVLHGTA ASPAQIHYNL WGQMDHHSRP  120
HSNHRGAVGI ASADLVSQIG FRRHVVSPTQ QALSLSLSSS QQAVAYGAAG ENEVVPVISP  180
SSNDGVGGFP GNSLSSTVSA VSNRIGSSGV QSMLLGSMYL KATQELLDEV VNVLGLKGEK  240
AANGAKEKAM KTNREPTPPA AIGGSHNSGG ESGSSKQSVE LSTAQRQELQ VKKAKLASML  300
DEVEQRYRQY HQQMHNVIIS FEQAAGFGSS KSYTALALKT ISKQFRCLKD AISAQIKATS  360
KSLGEEECLG VKIEGSRLRF VDHHLRQQRA LQQLGMVQHN NNAWRPQRGL PERAVSVLRA  420
WLFEHFLHPY PKTADKVMLA KQTGLTRSQV SNWFINARVR LWKPMVEEMY MEETKDQDQL  480
KGTSTTSQSG DDTNKRKANG ESSSAAANST ADHRTTVFQY SKSDHHINHS TDQISNSSFS  540
TSPVGGSFQE SAKKPRSTTT SSQVQNSPSS ILSMEHNRDI NPHHTFGRSE RQISTYQVGF  600
GQYPVSDLGR FHSTDHHHNH ELMAPRSFNG NGVSLTLGLP HCENHSLSSE AAPQSFLSNP  660
QNIDHLFD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-114TALE family protein