PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID POO01205.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 786aa    MW: 86465.8 Da    PI: 7.869
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
POO01205.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-096176541954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  POO01205.1 617 FEHflHPYPTDTDKHMLATQTGLTRNQVSNWFINARVR 654
                 664459******************************87 PP

2BELL110.69e-36468536472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+q+kk+kLl + eeV +rYkqy++q+q+v+ssFe vagl s++pY+slAl a+SrhFrcLk+ai++q+
  POO01205.1 468 EHQQKKTKLLYMHEEVSRRYKQYRQQMQMVVSSFESVAGLSSSTPYISLALEAVSRHFRCLKNAISDQL 536
                 89****************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    
MESTSGLSGV YRPESHVPQQ SRRDKLRVQQ ASSTLVVPIS HHLDYNPPIE PFTALHPENT  60
YNNIQHHNHV RNNRHNPNNF LFDPSFLSSE MLDFSRNNNN TQNNISVLHH HHQPHRINNT  120
NTLTCHDDHQ DHLSTTPAAA QTSERSSSSS MAIGDASFSF PHSKPNSEPA QGSSFINWRS  180
LHSNNSSNIP PQQSSFENWS SPTQNISGQK YLEAMVMSGN ELALLPSFVN QSTTLRFDNS  240
GSSSSQMETH QDEPYQKREQ DHHAELLRTS NLQGLSLSLS SNPQSATTLP NMPHPHHLGD  300
HHQESKPGEK SGYVGSVSMP KPSIISKACG SKSLQDIVGN INNASNPYRS SGPLGPFTGY  360
ATILKSSRFL RPAQQLLDDF CGSKGGINVK IACGEVSERI SGGGGVSGCV SASAVSGSCS  420
GDAVNAIETE VLGKGNNSCA SSSTFYGSNE ICGDGGVGSI SFECSKPEHQ QKKTKLLYMH  480
EEVSRRYKQY RQQMQMVVSS FESVAGLSSS TPYISLALEA VSRHFRCLKN AISDQLKHTR  540
RALGEDLSSP TTGSSISKGT TDALMSSTAR LKYMEQSFQK HKSSGPNLGF PEPQQPVWRP  600
QRGLPERSVA ILRAWLFEHF LHPYPTDTDK HMLATQTGLT RNQVSNWFIN ARVRVWKPMV  660
EEIHMLETKG LADQVVVDRN VNPGKNDHRV INNPENDQGT CGLSNTDQTS TKLGTIVMPN  720
KQLEGSGIGY SSSPGNRERD GSLLADQSQS HQEKRSRLEC QVPNSMAGAL LGFVPYHRTG  780
LEVWRQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.18e-76TALE family protein