PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON98999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 337aa    MW: 38532 Da    PI: 5.185
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON98999.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092803142155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  PON98999.1 280 KWPYPTEADKNALAETTGLDQKQINNWFINQRKRH 314
                 669*****************************885 PP

2ELK26.71.3e-09234255122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 +LK++Llr +++++g+Lk EFs
  PON98999.1 234 DLKDRLLRRFGSHIGTLKLEFS 255
                 69*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    
MDEMYGLQAT TAVEYSDKAL MSPENLILPS DYQTLISSAA VGFRDHQYHN HRLIFGSDDH  60
QDHHELLSAA SAAISEAASI TPEFQREEDV SNLIKAKIAS HPTYPRLLQA YIDCQKVGAP  120
PEIASFLEEI RRKNELYKRD SIISTCLGAD PELDEFMETY CDMLVKYKSD LARPFDEATT  180
FLNKIEVQLS NLCTTGATHT RGLSDEGAAS SDEEFSGGEV EGQQESQLRG EDRDLKDRLL  240
RRFGSHIGTL KLEFSKKKKK GKLPREARQT LLDWWNLHYK WPYPTEADKN ALAETTGLDQ  300
KQINNWFINQ RKRHWKPSEN MQFAVMDNLS GQFYRDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-130TALE family protein