PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON97805.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 746aa    MW: 82731.2 Da    PI: 6.9918
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON97805.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.6e-094755121954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  PON97805.1 475 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 512
                 554459******************************88 PP

2BELL120.47.9e-39334405172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e++elqk+k+kLls+l+eV++rYk+y++q+++v+ssFeavag g+a++Y +lA+ka+SrhFrcLkd i++qi
  PON97805.1 334 EFMELQKRKTKLLSMLDEVERRYKHYCDQMKAVVSSFEAVAGAGAATVYSALASKAMSRHFRCLKDGIVNQI 405
                 679********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    
MARELCEDKS RNMVSSAGFC YSDVSPSNNP SPAHIQTQFT NQIQDFHESN PEIFNLTTGM  60
EIIGFAKSTD ASTNDTTTAT TTNPSPSSSS MWKAFTISKA GPSSSKTINE STTSHDHHDH  120
DDHHQHQFYD HFTTGISETS SENLMVGPDQ HHHHHQQSTG GWAQENRFLV DDSSLRCVFP  180
CEGNEKPSQG LSLTLNSANP SSIGLQSFEL RQTNHHHQQD HHDHMRFISA NSRDGFFGKP  240
ANIQPQQMDI NINQDGFLGK SVNLHHQGQF QLRNSKYLNP AQELLNEFCS LGTKHTDLMT  300
KQKSQKLSKQ WEDQADNGSS GASSSKKQSL YSLEFMELQK RKTKLLSMLD EVERRYKHYC  360
DQMKAVVSSF EAVAGAGAAT VYSALASKAM SRHFRCLKDG IVNQIQATRK AMGEKDAAGA  420
APGTTRGETP RLRILDQTLR QQRAFQQMTM MESHPWRPQR GLPERSVSVL RAWLFEHFLH  480
PYPSDVDKHI LARQTGLSRS QVSNWFINAR VRLWKPMVEE MYLEETKERE ANNNNNSCSN  540
NNMGGASSDG AVTVDILRDP TRPPTRNQPE QDRKPTADQL VRIDSECLSS IVINPDKSGG  600
SSKSTLQNHQ HIQRQQNFGR FGEVSFGSSM QELDFSSYNQ AAGQSVLYAN HDQNNGNRHA  660
GFSGGGGGGG GVSLTLGLQQ HAGGGSHGGV SLAFSPASQS SLFYTRDHID DQCQPAAAVQ  720
YSLLDGEAQN LPYRNLMGAQ LLHDLA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-143TALE family protein