PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON91779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 152aa    MW: 17643 Da    PI: 9.4764
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON91779.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-09751102055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++++  LA+ +gL+ +q+ +WF N+R ++
  PON91779.1  75 YKWPYPSEAQKLALAETTGLDLKQINNWFINQRKRH 110
                 5679*****************************985 PP

2ELK42.51.4e-143051122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK qLlrKYsgyLgsLkqEF+
  PON91779.1 30 ELKVQLLRKYSGYLGSLKQEFL 51
                9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    
FGDFAGQDGS SKEEVGVNES FVDPQAEDKE LKVQLLRKYS GYLGSLKQEF LKKKKNGKLP  60
KEARQQLLEW WSRHYKWPYP SEAQKLALAE TTGLDLKQIN NWFINQRKRH WKSSGDKQLV  120
MMDGASPSPG HYYNMDNIMY NPFSMDFSST LL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-63TALE family protein