PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON91592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 483aa    MW: 53646.4 Da    PI: 6.6451
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON91592.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-074074402154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  PON91592.1 407 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 440
                 469*****************************87 PP

2ELK28.63.2e-10361382122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  PON91592.1 361 ELKHELKQGYKEKIVDIREEIL 382
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    
MAYHNHLSSQ DLPLHHHHHH HHHHFGDQTQ QQQQNHTILP DQLAIAHSSP DPTSKSVQTA  60
ASAPNWLNSA LLRTQPHAHF ADNANGNSHV SNSNNNTNFL NLHTASDSAN SGQASNQWLS  120
RPILQRNHSD VIDDVAAAAA AAAAAGESMI GGAMSHDSAA EMKAATAANG ENNLNKSEGV  180
VVESGGDGGV INWQNARYKA EILSHPLYDQ LLSAHVACLR IATPVDQLPR IDAQLAQSQN  240
VVAKYSALGQ GLVGDDKELD QFMTHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ  300
SLTGVSPGEG TGATMSDDDD DQVDSDANLF DGSLDGHDSM GFGPLIPTES ERSLMERVRQ  360
ELKHELKQGY KEKIVDIREE ILRKRRAGKL PGDTTSVLKA WWQSHSKWPY PTEEDKARLV  420
QETGLQLKQI NNWFINQRKR NWHSNPSTST VLKSKRKRYS LHDQFKFQTN TMQFSRLVDS  480
HFS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1438458RKRNWHSNPSTSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0TALE family protein