PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON91297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 293aa    MW: 33673 Da    PI: 6.622
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON91297.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092202542155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps++++  LA+++gL+++q+ +WF N+R ++
  PON91297.1 220 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 254
                 569*****************************885 PP

2ELK41.52.8e-14174195122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLlrKYsgyLgsLkqEF+
  PON91297.1 174 ELKGQLLRKYSGYLGSLKQEFM 195
                 9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    
MVDDHHNHHQ HQNNNSNINP TGGCYFMAEN NNDSTNISSF KAKIMAHPHY HRLLAAYVNC  60
QKVGAPPEVV ARLEEACSSA AVMGHMSTGC LGEDPALDQF MEAYCEMLTK YEQELSKPFK  120
EAMLFLQRIE CQFKALTLSS DSACCEANID RTGSSEEEVD VNNNFIDPQA EDRELKGQLL  180
RKYSGYLGSL KQEFMKKRKK GKLPKEARQQ LLDWWSRHYK WPYPSESQKL ALAESTGLDQ  240
KQINNWFINQ RKRHWKPSED MQFVVMDAAH PHHYYMDNVL GNPFPMDISP ALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190199LKQEFMKKRK
2196200KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-146TALE family protein