PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON90969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 580aa    MW: 65024.4 Da    PI: 6.0451
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON90969.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.5e-103824191954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  PON90969.1 382 FEHflHPYPKESEKVVLAKQTGLSTKQVANWFINARVR 419
                 664459******************************88 PP

2BELL114.74.6e-37249319272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +q+lq+kk+kL+++l+e+d+rYkqy++q+qtv+s  + vag g+a+pYtslA+k+iSrhFrcL+dai++qi
  PON90969.1 249 QQDLQNKKTKLMTMLDEIDRRYKQYYHQMQTVMSFLDNVAGRGAAEPYTSLAQKTISRHFRCLRDAISGQI 319
                 689*******************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    
MSTYVPNLGI KKCDLATTGY VDETYVTCPE PSLSQASSAG PFSMTFHNSS NYCVDSAEGR  60
NEMMFIPPIA TDPVGSSITG DSLVNQNVHY QGQGLSLSLG KQIPSPVSLT SFQYQYPNPS  120
LSTDLGTCLP SIGSNQNVEC FNMASGFLGM NNNSIKTEGF GNQVMQGDQR YEYESSGFDN  180
NFFNFKYLRA AQGLLDEVVN VRKALNKHQN KFQGMGSDGL KESDLKSNGP SDPSESTANS  240
SCELSPAKQQ DLQNKKTKLM TMLDEIDRRY KQYYHQMQTV MSFLDNVAGR GAAEPYTSLA  300
QKTISRHFRC LRDAISGQIQ AIQRRLGEQD NGQTSAIPRL RYVDLKLRQQ RGLNQLAAMR  360
HAWRPQRGLP ESSVSILRAW LFEHFLHPYP KESEKVVLAK QTGLSTKQVA NWFINARVRL  420
WKPMVEEMYK EEFNELEMNS KEAGVDSSSE DRREELNNPL QTQNRRLLEE GNVTDSETTK  480
SPADNHGVFL DDEAVRTTNQ ASYDDISELS SIVVRNNRRV SLALELRHCE SDGFSTLAGS  540
HMRGGGDESA AASLDYHCLE TEQQERRRFS NPHLLHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-123TALE family protein