PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON90968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 472aa    MW: 52390.8 Da    PI: 5.7677
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON90968.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.4e-103944311954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt++qV++WF N R +
  PON90968.1 394 FEHflHPYPNDSEKLMLASQTGLTKNQVSNWFINARVR 431
                 664459******************************88 PP

2BELL1019.1e-33256327172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+qe q k akL+slleeV+ rY++y++ql+ ++++F++vag g+ak+Yt+lAl+a+SrhF +L+dai+++i
  PON90968.1 256 EKQESQVKMAKLISLLEEVEGRYEKYYHQLEEIMAAFDMVAGSGAAKSYTALALQAMSRHFCSLRDAIVSRI 327
                 689*****************************************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    
MVSQDSPPHP DTNIVHQFLI SDNISTQTQF ENQHFNAYGS NFRGNNITFP PSLGALPSIQ  60
SLGERMSRSI DLVQPQTTAE ESQLSHTRRL MDLLGAANDT NHQAQRLSLS LGSHMLVPSV  120
EYRQRSFNSD LITPSYLISG EEEAREVCNP GLEHVNDNYP FSGTSLASSS ASLNRSYSTL  180
YGAESLATVI SHSRYLKPTQ SLLEEIVNVG GKAVEISNEK YVDMLLRGGR RGGGGALSLS  240
SELKAELCSS GIISAEKQES QVKMAKLISL LEEVEGRYEK YYHQLEEIMA AFDMVAGSGA  300
AKSYTALALQ AMSRHFCSLR DAIVSRINVE KRKLLQDLPK ISAGLSQLSL FDRETRNNRI  360
SLQQLGMIQS QRQAWRPIRG LPETSVAILR AWLFEHFLHP YPNDSEKLML ASQTGLTKNQ  420
VSNWFINARV RLWKPMIEEM YKEEFGDSSD DSNPLGGGGP MTGEGVTDHE ED
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228235GGRRGGGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-101TALE family protein