PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON90786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 664aa    MW: 71673.9 Da    PI: 7.2195
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON90786.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-094544911954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  PON90786.1 454 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 491
                 554459******************************88 PP

2BELL107.49.3e-35323390572
        BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +kkk++L+s+l+eV++rYkqy++q+q+v+ sFe vaglg+a+pY++lA k++++hFrcLk+ai++q+
  PON90786.1 323 SRKKKSRLISMLDEVYRRYKQYYQQMQAVVTSFEYVAGLGNAAPYANLAVKTMTKHFRCLKNAIMDQL 390
                 689**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    
MAEGFEPYHV PQQSRRDKLR VVATQSTHHP SSASACIEEA AAAAAAASFH GCAATGLLPL  60
TSSYDPSDLL TCAPHPHLSP AAGVGKQSPV PAGCGTAVVA KEEGVVNLMG LVNGSSSTSS  120
SSNFRNPFLD PASIQDINNN PFLFSSQALQ NLRDFDHHGF NNGVFKPEPL SLSLSSHRDP  180
TRIQNTDNNN HNSSNTNVPL ELNLQRFGSA IYGGGSTTNA NNTTTVAIVG GGGDDGVGSR  240
SAVPLGPFTG YASILKGSRF LKPAQQLLEE FCEVGGRVVY PEKLTGDSSL MESPVESLSS  300
GAGGLNVDEV ELSSGVTDGS ESSRKKKSRL ISMLDEVYRR YKQYYQQMQA VVTSFEYVAG  360
LGNAAPYANL AVKTMTKHFR CLKNAIMDQL QFSNKDNSHT NHGKEEVPIF RNSNRGVYSQ  420
RPIHGSGFLE HQPVWRPQRG LPERAVTVLR AWLFEHFLHP YPTDTDKLML AKQTGLSRSQ  480
VSNWFINARV RLWKPMVEEI HMLETRQAQK ASQREDRNSS RPSAHEHIPS ANSLAGENPS  540
TSIHRVHDNT SKRTRNDVPH NMPVAGGSEE MSLTYDNLPS HLQVGAAAMS MAGVGSNGVS  600
LTLGLHQNNG GIGLSEPFPI NAAQRFGLGL EGNGEGYVMG AFEAQNRHFG RDVIGGQLLH  660
DFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-104TALE family protein