PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON86205.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 404aa    MW: 46135.9 Da    PI: 6.7393
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON86205.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-093323662155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps++e+  LA+++gL+++q+ +WF N+R ++
  PON86205.1 332 KWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 366
                 669*****************************885 PP

2ELK36.79.2e-13286307122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++LlrKYsgyL++LkqE+s
  PON86205.1 286 ELKNHLLRKYSGYLSGLKQELS 307
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    
MDQDYNQMDE NSGAARGNFL YSSGNMQGGN GNYGRGSHDH QLSTVNSFHL QSTAGAGGGD  60
HCSGFQSASS GPHQHHHQPI VKTEASTSHH HNHLIQKFHY PNLMTRDHHD QTVQQVHHDQ  120
LPQNHDHDHD HPHRSKEVEA IKAKIIGHPQ YSNLLEAYMD CQKVGAPAEV VARLGAARQD  180
FEARQRSSVS TRETSSKDPE LDQFMEAYYD LLVKYRDELT RPIQEAMDFM RRIETQLNML  240
SNGGPVRIFT SDHDKCEGVG SSEEDQDNSG GETEVPEIDP RAEDRELKNH LLRKYSGYLS  300
GLKQELSKKK KKGKLPKDAR QKLLSWWELH YKWPYPSETE KVALAESTGL DQKQINNWFI  360
NQRKRHWKPS EDMQFMVMDG LHPQNAALYM DGHYMGDGHY RLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-141TALE family protein