PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON84503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 340aa    MW: 38130 Da    PI: 5.9849
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON84503.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.2e-082663012055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++++  LA+ +gL+ +q+ +WF N+R ++
  PON84503.1 266 YKWPYPSEAQKLALAETTGLDLKQINNWFINQRKRH 301
                 5679*****************************885 PP

2ELK414.1e-14221242122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLlrKYsgyLgsLkqEF+
  PON84503.1 221 ELKVQLLRKYSGYLGSLKQEFL 242
                 9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    
MDQFGEKSSS TSTSCGVSCS VLMMNNTTNN NMPLPLDAGA GTGNQRVTVA ALNMLPQGSG  60
TNGNYVRHFC NEESSNTTNT CSTMMRAKIM AHPLFPRLLT AYANCQKVGA PPEVVARLEE  120
ACAYNYNNIS RSSSGGCIGE DGGQDPALDQ FMEAYCEMLT KYEQELTKPF KEAMLFLSRV  180
ESQLKTLTLS STTTDSGQNG SSEEEVDVND SFVDPQAEDK ELKVQLLRKY SGYLGSLKQE  240
FLKKKKNGKL PKEARQQLLE WWSRHYKWPY PSEAQKLALA ETTGLDLKQI NNWFINQRKR  300
HWKPSEDMQF VVMDAAHPGH YYMDNIMYNP FSMDCSSTLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-121TALE family protein