PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON77402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 685aa    MW: 74464.6 Da    PI: 6.3506
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON77402.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094244611954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  PON77402.1 424 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 461
                 664459******************************88 PP

2BELL127.83.8e-41286357172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+q+lq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+a+ag+gsakpYt+lAl++iSrhFrcL daia+qi
  PON77402.1 286 EKQDLQNKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDAIAGCGSAKPYTALALQTISRHFRCLHDAIAGQI 357
                 6899*******************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    
MATYYSSSNN QRDTAPMLYS REHLTSSYPE ASVLPSNMMM YMNSGSYSDA LAANSQQQSN  60
CMEMPPMGPS DSAPQPQDIL SNLGGSRMGE HDFSEWREGK NDLVVTHSMG GAPSILHGGQ  120
NLQGQGLSLS LGTQIPSGMH MPSISFRNPN MGFASFLSPN PSVSGEGGGR NGSSRDEQPR  180
NVEYLAPGFP GGVNQDSSKG ELSPYGLSSI ARTVPSSKYL KAAQQLLDEV VNVRKALKRN  240
DSEKAQGAQE QGMKSPKEGD DGSKNESTPG GGESASNSQP ELSHAEKQDL QNKLTKLLSM  300
LDEVDRRYKQ YYHQMQIVVS SFDAIAGCGS AKPYTALALQ TISRHFRCLH DAIAGQIKAT  360
RKSLGEQDAS GNVKGVGISR LRFVDQQLRQ QRALQQLGMM QQHAWRPQRG LPESSVSILR  420
AWLFEHFLHP YPKDSDKIML ARQTGLTRSQ VSNWFINARV RLWKPMVEEM YKEETGDAEM  480
DSNSSSENAA KATKGDTRTS EDRGGDLQQS ASSTGTERCS TGQFMDSKVN HVPDVEMAGS  540
VGSATFHNLT RREAEAEYGL MKQQRREEQR PGMDDCSSLF PDAIVQSDGS SERFMAAAAA  600
YHMSELGRFG GGTGVSLTLG LQHCDGGSIP MSSGTHHSFV AMRGDDLYNA AASSVGAETA  660
DFECVNSGNQ QPRFASSHLL HDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-117TALE family protein