PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON64052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 289aa    MW: 32753.9 Da    PI: 6.5755
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON64052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.3e-082382712154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  PON64052.1 238 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 271
                 469*****************************87 PP

2ELK25.53e-09192213122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  PON64052.1 192 ELKIELKQGFKSRIEDVREEIL 213
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    
MQEAGFGMMG GSNISTSGGG DDQDRHLKAE IATHPLYEQL LAAHVSCLRV ATPIDQLPLI  60
DAQLSQSHHL LRSYASLAHS SHLSPHDRQD LDNFLAQYLI VLCTFKEQLQ QHVRIHAVEA  120
VMACREIENT LQALTGVSLG EGTGATMSDD EDEMQMDFSL DQSGGDANDM MGFGPLLPTE  180
SERSLMERVR HELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTTVLK NWWQQHSKWP  240
YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1269289RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-163TALE family protein