PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON59672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 187aa    MW: 21917.2 Da    PI: 8.874
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON59672.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-091271612155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 + +yp+++++  LA+ +gL+++q+ +WF N+R ++
  PON59672.1 127 RWPYPTETDKIALAELTGLDQKQINNWFINQRKRH 161
                 569*****************************885 PP

2ELK38.32.8e-1381102122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK+ LlrKYsgy+++Lk+EFs
  PON59672.1  81 ELKDKLLRKYSGYISTLKHEFS 102
                 9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    
MRTMIVGPTL MWYMPGDQSH HIPWILSWPP FYHICKNPAH PACVRACVHT EPGGSSEEDQ  60
LSGGEIEVVD SLRMITSEDR ELKDKLLRKY SGYISTLKHE FSKKKKKGKL PKEARQILLD  120
WWSMHYRWPY PTETDKIALA ELTGLDQKQI NNWFINQRKR HWKPPENMQV ALMEAHSHYG  180
PSLCHNQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.21e-46TALE family protein