PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON51250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 378aa    MW: 43198.1 Da    PI: 4.7266
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON51250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.52e-073283602254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +yp++e++++L +++gL+ +q+ +WF N+R +
  PON51250.1 328 WPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 360
                 58*****************************87 PP

2ELK26.71.3e-09281302122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++L+++Y+++++++++E++
  PON51250.1 281 ELKQELKQGYKEKIVDIREEIL 302
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    
MAFHHHHNHN TNLPQEMAFH QNPFTDQPSL SATGEDDGVG APTWLNSSVF RQQNLLHLLA  60
ESEPRNDDVL GASEGSSKMS DFIGDRRNRR DEVEVEVEEE EVEVEVEEDD EESAEGPWYK  120
ADILRHPLYD QLLSAHVSCL RIATPVDQLP RIDEQLSQSQ RVVSKYSDLG VRVVDEKELD  180
QFMTNYVILL CSLKEQLQQH VRVHAMEAVM ACWELEQSLQ SLTGVSPGEG TGATMSDDNE  240
DQVDSDVNLY DGSLDGPDSM GFGPLVPTET ERSLMERVRE ELKQELKQGY KEKIVDIREE  300
ILRKRKAGKL PGGTTSLLKA WWQSHSKWPY PTEEDKAKLV QETGLQLKQI NNWFINQRKR  360
NWHNNMSPVP SSKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358378RKRNWHNNMSPVPSSKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-152TALE family protein