PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON37408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family TALE
Protein Properties Length: 474aa    MW: 53082.4 Da    PI: 9.2317
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON37408.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.11.9e-102953321954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +e+  LA+++gL+ +qV++WF N R +
  PON37408.1 295 FEHflHPYPSDSEKHMLAQQTGLSRTQVSNWFINSRVR 332
                 664459******************************88 PP

2BELL76.83.2e-25156226272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 r e q k ++L+ +leeV+kr k y++q+q v+ sFe+vagl +a+p++s A +aiS hF +Lk+ai +q+
  PON37408.1 156 RVEYQFKYSRLMFMLEEVYKRCKLYCQQIQSVVTSFETVAGLANAAPFVSSAIRAISNHFGSLKNAILDQL 226
                 7899****************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    
MAEGFELFHV PQKIRIQKLP LTIQTTPPPP LSTVPNDTVF NSHHYDDHIL LPSSRHAPTS  60
NPPPPLYQLF SHDTPNGVVS LREEHHFAVA DANGFRSSVP LGPFTGYASI LRRSSFLKPA  120
QQLLDEFCGS GRRVWDDPTM DELSRGGKDP SGVSDRVEYQ FKYSRLMFML EEVYKRCKLY  180
CQQIQSVVTS FETVAGLANA APFVSSAIRA ISNHFGSLKN AILDQLNYST RTTTNQVADC  240
IAIKDDNQNS SLVWASKTGL GPNPIHNLTN IHRTAWRSQR GLPEHAVGLL RKWLFEHFLH  300
PYPSDSEKHM LAQQTGLSRT QVSNWFINSR VRLWKPMVEE IQVLQTQQTT QPHSETKTNH  360
NANISSLKSY LENPTSKENF PLRTSGEKGR EILTKRSRND GHGSSSHVQQ SEKQSNSIVA  420
YIGNSTSNNS SGSAPLNVNL QSNSGIESSQ SFSRPIGQHF NLFTSGEAAF KNWF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.14e-77TALE family protein