PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 611aa    MW: 67688.5 Da    PI: 5.1192
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-09315361652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.8 315 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 361
                       667899***************************************99 PP

2PHD30.96.3e-1162115150
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50 
                       +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.8  62 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 115
                       6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    
NSREKLKPEK ELQRAKRQII KCKIAIRDII HQLDLYSSSG SMEDSVMPPD ESVKSVNPDN  60
TICSRCKSPE SVPNNKFIFC EGACKMAYHE KCSEPPLDRS LPTGGPGWLC KFCLCKMKIL  120
EAVNAHLGTS LTVMCPSKDI FKEATKEVDS EDGLGEDWLS EYSGDEDYDP EENDFTSSSL  180
DSGEESISDQ SNCSGSPLYS PNDDIPGFIS ADFTDAEGFY HTNSNLGIDS GDDDVAEMLT  240
YQRPKREVDY KRLNEEMFGK LTENEKQSED EDWGTNNRRK KRRVHSAGVG VKSAEGLSDV  300
KSNEKAQPQR RKLFRIPPEA VQVLRKSFAE SELPAREVKE SLSTELGISF EKIDKWFKNT  360
RCAALRDRKA EGNSRVAGPS KRSRRSAGKS GSSVKIDSVD NSYLIPASEI ISVPTHPQGI  420
PERKPESTSR TVRRLVHDKG APLCPPAEVK ESTSPTTKPG LNPSHVADRI INTEHRAASR  480
EAPVAFSDDP FFDAILSYPT INTNDRAVSR EDPLAFSDDP FLDVMLANRD IYTEERAVSH  540
EDVKRPSGDQ PFLDVIQNVC GLEHRLQRLK GDMLSSGAAP GGAGTAERDL QNQLVVLVPT  600
AELKDKSQPS I
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.23e-61HB-PHD family protein