PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 423aa    MW: 46746 Da    PI: 4.981
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-09274320652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.3 274 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 320
                       667899***************************************99 PP

2PHD31.63.8e-112174150
                      SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
               PHD  1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50
                      +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.3 21 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 74
                      6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    
MEDSVMPPDE SVKSVNPDNT ICSRCKSPES VPNNKFIFCE GACKMAYHEK CSEPPLDRSL  60
PTGGPGWLCK FCLCKMKILE AVNAHLGTSL TVMCPSKDIF KEATKEVDSE DGLGEDWLSE  120
YSGDEDYDPE ENDFTSSSLD SGEESISDQS NCSGSPLYSP NDDIPGFISA DFTDAEGFYH  180
TNSNLGIDSG DDDVAEMLTY QRPKREVDYK RLNEEMFGKL TENEKQSEDE DWGTNNRRKK  240
RRVHSAGVGV KSAEGLSDVK SNEKAQPQRR KLFRIPPEAV QVLRKSFAES ELPAREVKES  300
LSTELGISFE KIDKWFKNTR CAALRDRKAE GNSRVAGPSK RSRRSAGKSG SSVKIDSVDN  360
SYLIPASEII SVPTHPQGIP ERKPESTSRT VRRLVHDKGA PLCPPAEVKE STSPTTKPGL  420
NPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.26e-52HB-PHD family protein