PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 764aa    MW: 85196.3 Da    PI: 8.168
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-09468514652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.2 468 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 514
                       667899***************************************99 PP

2PHD30.58.4e-11204257150
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50 
                       +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.2 204 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 257
                       6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    
MDNSDKKSVC SIPRRSSERR KQSSSELVSS AKRPTRHNTS SSYKPDHCSP PKRTVRTVRN  60
VNLAKYIKNK YYRSPLSKRQ SSNVATGKSA TGPVRRRNRK RRRHNTDCDE ATRMERRARY  120
LLVKIKSEQN LIDAYSGECA FPNSREKLKP EKELQRAKRQ IIKCKIAIRD IIHQLDLYSS  180
SGSMEDSVMP PDESVKSVNP DNTICSRCKS PESVPNNKFI FCEGACKMAY HEKCSEPPLD  240
RSLPTGGPGW LCKFCLCKMK ILEAVNAHLG TSLTVMCPSK DIFKEATKEV DSEDGLGEDW  300
LSEYSGDEDY DPEENDFTSS SLDSGEESIS DQSNCSGSPL YSPNDDIPGF ISADFTDAEG  360
FYHTNSNLGI DSGDDDVAEM LTYQRPKREV DYKRLNEVGA LTAFHPSQEM FGKLTENEKQ  420
SEDEDWGTNN RRKKRRVHSA GVGVKSAEGL SDVKSNEKAQ PQRRKLFRIP PEAVQVLRKS  480
FAESELPARE VKESLSTELG ISFEKIDKWF KNTRCAALRD RKAEGNSRVA GPSKRSRRSA  540
GKSGSSVKID SVDNSYLIPA SEIISVPTHP QGIPERKPES TSRTVRRLVH DKGAPLCPPA  600
EVKESTSPTT KPGLNPSHVA DRIINTEHRA ASREAPVAFS DDPFFDAILS YPTINTNDRA  660
VSREDPLAFS DDPFLDVMLA NRDIYTEERA VSHEDVKRPS GDQPFLDVIQ NVCGLEHRLQ  720
RLKGDMLSSG AAPGGAGTAE RDLQNQLVVL VPTAELKDKS QPSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103RKRRR
299126RKRRRHNTDCDEATRMERRARYLLVKIK
3100127RKRRRHNTDCDEATRMERRARYLLVKIK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.22e-71HB-PHD family protein