PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 567aa    MW: 62441.4 Da    PI: 4.805
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.17genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-09271317652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.17 271 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 317
                        667899***************************************99 PP

2PHD315.7e-112679150
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
                PHD  1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50
                       +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.17 26 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 79
                       6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    
IIHQLDLYSS SGSMEDSVMP PDESTICSRC KSPESVPNNK FIFCEGACKM AYHEKCSEPP  60
LDRSLPTGGP GWLCKFCLCK MKILEAVNAH LGTSLTVMCP SKDIFKEATK EVDSEDGLGE  120
DWLSEYSGDE DYDPEENDFT SSSLDSGEES ISDQSNCSGS PLYSPNDDIP GFISADFTDA  180
EGFYHTNSNL GIDSGDDDVA EMLTYQRPKR EEMFGKLTEN EKQSEDEDWG TNNRRKKRRV  240
HSAGVGVKSA EGLSDVKSNE KAQPQRRKLF RIPPEAVQVL RKSFAESELP AREVKESLST  300
ELGISFEKID KWFKNTRCAA LRDRKAEGNS RVAGPSKRSR RSAGKSGSSV KIDSVDNSYL  360
IPASEIISVP THPQGIPERK PESTSRTVRR LVHDKGAPLC PPAEVKESTS PTTKPGLNPS  420
HVADRIINTE HRAASREAPV AFSDDPFFDA ILSYPTINTN DRAVSREDPL AFSDDPFLDV  480
MLANRDIYTE ERAVSHEDVK RPSGDQPFLD VIQNVCGLEH RLQRLKGDML SSGAAPGGAG  540
TAERDLQNQL VVLVPTAELK DKSQPSI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.23e-27HB-PHD family protein