PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 595aa    MW: 65881.5 Da    PI: 5.0021
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.16genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-09299345652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.16 299 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 345
                        667899***************************************99 PP

2PHD30.96.1e-114699150
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
                PHD  1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50
                       +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.16 46 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 99
                       6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    
EKELQRAKRQ IIKCKIAIRD IIHQLDLYSS SGSMEDSVMP PDESTICSRC KSPESVPNNK  60
FIFCEGACKM AYHEKCSEPP LDRSLPTGGP GWLCKFCLCK MKILEAVNAH LGTSLTVMCP  120
SKDIFKEATK EVDSEDGLGE DWLSEYSGDE DYDPEENDFT SSSLDSGEES ISDQSNCSGS  180
PLYSPNDDIP GFISADFTDA EGFYHTNSNL GIDSGDDDVA EMLTYQRPKR EVDYKRLNEE  240
MFGKLTENEK QSEDEDWGTN NRRKKRRVHS AGVGVKSAEG LSDVKSNEKA QPQRRKLFRI  300
PPEAVQVLRK SFAESELPAR EVKESLSTEL GISFEKIDKW FKNTRCAALR DRKAEGNSRV  360
AGPSKRSRRS AGKSGSSVKI DSVDNSYLIP ASEIISVPTH PQGIPERKPE STSRTVRRLV  420
HDKGAPLCPP AEVKESTSPT TKPGLNPSHV ADRIINTEHR AASREAPVAF SDDPFFDAIL  480
SYPTINTNDR AVSREDPLAF SDDPFLDVML ANRDIYTEER AVSHEDVKRP SGDQPFLDVI  540
QNVCGLEHRL QRLKGDMLSS GAAPGGAGTA ERDLQNQLVV LVPTAELKDK SQPSI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.27e-56HB-PHD family protein