PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 596aa    MW: 65970.7 Da    PI: 5.1071
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.11genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-09296342652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.11 296 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 342
                        667899***************************************99 PP

2PHD30.96.1e-1151104150
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50 
                        +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.11  51 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 104
                        6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    
EKLKPEKELQ RAKRQIIKCK IAIRDIIHQL DLYSSSGSME DSVMPPDEST ICSRCKSPES  60
VPNNKFIFCE GACKMAYHEK CSEPPLDRSL PTGGPGWLCK FCLCKMKILE AVNAHLGTSL  120
TVMCPSKDIF KEATKEVDSE DGLGEDWLSE YSGDEDYDPE ENDFTSSSLD SGEESISDQS  180
NCSGSPLYSP NDDIPGFISA DFTDAEGFYH TNSNLGIDSG DDDVAEMLTY QRPKREEMFG  240
KLTENEKQSE DEDWGTNNRR KKRRVHSAGV GVKSAEGLSD VKSNEKAQPQ RRKLFRIPPE  300
AVQVLRKSFA ESELPAREVK ESLSTELGIS FEKIDKWFKN TRCAALRDRK AEGNSRVAGP  360
SKRSRRSAGK SGSSVKIDSV DNSYLIPASE IISVPTHPQG IPERKPESTS RTVRRLVHDK  420
GAPLCPPAEV KVQRQESTSP TTKPGLNPSH VADRIINTEH RAASREAPVA FSDDPFFDAI  480
LSYPTINTND RAVSREDPLA FSDDPFLDVM LANRDIYTEE RAVSHEDVKR PSGDQPFLDV  540
IQNVCGLEHR LQRLKGDMLS SGAAPGGAGT AERDLQNQLV VLVPTAELKD KSQPSI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.26e-31HB-PHD family protein