PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG021410.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 603aa    MW: 66670.4 Da    PI: 5.1106
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG021410.10genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-09307353652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        ++ +e +++L + F+++  p +e +e L+++lg++ +++  WF+N R
  TRIDC6BG021410.10 307 RIPPEAVQVLRKSFAESELPAREVKESLSTELGISFEKIDKWFKNTR 353
                        667899***************************************99 PP

2PHD30.96.2e-1162115150
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCke 50 
                        +C+ C++  s  ++++++C+g Ck ++H kC +++l+++    g  wlC+ C +
  TRIDC6BG021410.10  62 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCSEPPLDRSLPTGGpGWLCKFCLC 115
                        6999**987778*******966**************966555559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    
NSREKLKPEK ELQRAKRQII KCKIAIRDII HQLDLYSSSG SMEDSVMPPD ESVKSVNPDN  60
TICSRCKSPE SVPNNKFIFC EGACKMAYHE KCSEPPLDRS LPTGGPGWLC KFCLCKMKIL  120
EAVNAHLGTS LTVMCPSKDI FKEATKEVDS EDGLGEDWLS EYSGDEDYDP EENDFTSSSL  180
DSGEESISDQ SNCSGSPLYS PNDDIPGFIS ADFTDAEGFY HTNSNLGIDS GDDDVAEMLT  240
YQRPKREEMF GKLTENEKQS EDEDWGTNNR RKKRRVHSAG VGVKSAEGLS DVKSNEKAQP  300
QRRKLFRIPP EAVQVLRKSF AESELPAREV KESLSTELGI SFEKIDKWFK NTRCAALRDR  360
KAEGNSRVAG PSKRSRRSAG KSGSSVKIDS VDNSYLIPAS EIISVPTHPQ GIPERKPEST  420
SRTVRRLVHD KGAPLCPPAE VKESTSPTTK PGLNPSHVAD RIINTEHRAA SREAPVAFSD  480
DPFFDAILSY PTINTNDRAV SREDPLAFSD DPFLDVMLAN RDIYTEERAV SHEDVKRPSG  540
DQPFLDVIQN VCGLEHRLQR LKGDMLSSGA APGGAGTAER DLQNQLVVLV PTAELKDKSQ  600
PSI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.22e-33HB-PHD family protein