PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG015580.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 763aa    MW: 84877.9 Da    PI: 7.7507
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG015580.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.6e-10465511652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++ +e +++L + F+++  ps+e +e L+++lg++ +++  WF+N R
  TRIDC6AG015580.5 465 RIPPEAVQVLRKSFAESELPSREVKENLSTELGISFEKIDKWFKNTR 511
                       667899***************************************99 PP

2PHD331.4e-11201254150
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCke 50 
                       +C+ C++  s  ++++++C+g Ck ++H kCl+++l+++    g   wlC+ C +
  TRIDC6AG015580.5 201 ICSRCKSpeSVPNNKFIFCEGaCKMAYHEKCLEPPLDKSLP-TGgpGWLCKFCLC 254
                       6999**987778*******966**************95555.4559*******86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    
MNNSDKKSAC SIPRRSSERR KQSSSELVSS AKRSTGHNTS SSYKPDHCSP PKRTVRTVRN  60
VNLAKYIKNK YYRSPLSKRQ ASNAATGKTA TGPVRRRNRK RRRHNTDCDE ATRMERRARY  120
LLVKIKSEQN LIDAYSGDGW NGHSREKLKP EKELQRAQKQ IIKCKIAIRD IIHQLDLYSS  180
SGSMEDSVMP PDESVNPDNT ICSRCKSPES VPNNKFIFCE GACKMAYHEK CLEPPLDKSL  240
PTGGPGWLCK FCLCKMKILE AVNAHLGTSL TVMCPSKDIF KEATKQMDSE DGLGEDWLSE  300
YSGDEDYDPE ENDFTSSSLD SGEESISDQS NCSGSPLYSP NDDIPGFISA DFTDAEGFYH  360
TNSNLGIDSD DDDVAEMLTY QRSKLLISIT LVQQVGALTA FHPSQEMFGK LTENEKQSED  420
EDWGTNNRRK KRRVDSAGVG VKSAEGSLDV KSNEKAQPQR RKLFRIPPEA VQVLRKSFAE  480
SELPSREVKE NLSTELGISF EKIDKWFKNT RCAALRDRKA EGNSRVAGPS KRSKQSAGKS  540
GSLGKIDSVD NSYLLPMPEI ISVPTHPQGI PERKPESTSR TVRRRVHDKG APLCPPAPAE  600
VKESTSPTTK PGLNPSHVAD RIINTEHRAA SREDPVAFSD DPFFDAILSY PTINTNDRAV  660
SREDPVAFSD DPFLDVMLAN RDIYTEERAA SHEDVRRPSS DQPFLDVIQN VCGLEHRLQR  720
LKGDMLSSAA APGGAGTAER DLQNQLVVLV PTAELKDKSQ PSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103RKRRR
299126RKRRRHNTDCDEATRMERRARYLLVKIK
3100127RKRRRHNTDCDEATRMERRARYLLVKIK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.26e-50HB-PHD family protein