PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG045780.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 595aa    MW: 64734.1 Da    PI: 4.4655
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG045780.12genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093543931352
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        + L+++Fek++yps+ ++e L ++lgLt  q++ WF   R
  TRIDC3BG045780.12 354 QKLKAYFEKEPYPSRPAKESLGQELGLTFHQITRWFSSTR 393
                        68**********************************8776 PP

2PHD42.71.3e-14358151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD  1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51
                       +C++C +   + +++++lCdg C++ fH+kCl+++l  e++p+g   wlC+ C++k
  TRIDC3BG045780.12  3 FCAICASkhVTLKNDIILCDGvCDRGFHQKCLNPPLLAEDIPQGdeGWLCPACDCK 58
                       7******65555********77*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    
MIFCAICASK HVTLKNDIIL CDGVCDRGFH QKCLNPPLLA EDIPQGDEGW LCPACDCKLD  60
CIDLLNELQG STLAIHDSWE KVFPESTSNG LNQIGASDLP SDDSEEDYDP TLAEGDTVDE  120
DKSSAEDGDE GSDSDDLDFI TSSDESEPSK KKKSESKNKN TVNDLALPSD DSEDDDFDPE  180
GPNSSEDQKT KTNSDESDFT SDSDDFCAEI SKSSGKDKVS APSFSDQTNG VDIMEAELEQ  240
DSVLPASNRR QVGTLDYKKL YDEAYGKETT DSSDEKEWSG HSPNGNPEDS DTDSFAGPLK  300
PAKTRRARGG RQNNERTAQS ERHSGSVSEQ HPEVLSNGTS STARKKGYGP IVNQKLKAYF  360
EKEPYPSRPA KESLGQELGL TFHQITRWFS STRHYSRVTA TKKGKRSENY TAENNDGIAA  420
DSIQQREPNG SVLGKPNVDR NGIISEERMA QKNLDEGEKE DTPFRQRISC EQTLDGTPAN  480
KHNTANSREV DPPIGAPGGN QQSDTSRNAE DTPLGQDIGC EQTVAAINQN CTIGSSNVGS  540
PKGVPGGNKR LNNSPSVGSP RRGSAEKNIP GLEHVDEARR KAILRELRKM KAAGK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-36HB-PHD family protein