PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG040620.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 821aa    MW: 90197.1 Da    PI: 6.4769
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG040620.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.21.9e-105926311352
                       HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       + L+++Fek++yps+ ++e LA++lgLt  q++ WF   R
  TRIDC3AG040620.5 592 QKLKAYFEKEPYPSRPAKESLAQELGLTFHQITRWFSSTR 631
                       78**********************************8776 PP

2PHD42.12e-14241296151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C++C +   + +++++lCdg C++ fH+kCl+++l  e++p+g   wlC+ C++k
  TRIDC3AG040620.5 241 FCAICASkhVTLKNDIILCDGvCDRGFHQKCLNPPLLAEDIPQGdeGWLCPACDCK 296
                       7******65555********77*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    
MGKTSASGVV QENEKVGNGS PSSPTKGKRG RKGSQIIANK KYPLRSAHSS TRVLRSTSKD  60
KSKTPNEPVS PLRSAHSSPR VLRSTPKNKS KTPKKQVNSL RSAHSSARVL SSTLKKKVPN  120
EPVNDSTAAQ PAARKRKRGR PSNAASPKNE CIKIRQRVRY ILNRMNYEQS FIQAYAGEGW  180
KGQSLEKIRP EKELERAKAE ILRCKLRIRE AFRNMDSLLL EGKLDESLFD SEGEISSEDI  240
FCAICASKHV TLKNDIILCD GVCDRGFHQK CLNPPLLAED IPQGDEGWLC PACDCKLDCI  300
DLLNELQGST LAMHDSWEKV FPESTSNGLN QIGASDLPSD DSEEDYDPTL AEGDTVDENK  360
SSAEDGDEGS DSDDLDFITS SDESEPSKKK RSESKNKNTV NDLALPSDDS EDDDFDPEGP  420
NSSEDQKTKT NSDESDFTSD SDDFCAEISK SSGKDKVSAP SFSDQTNGVD IMEAELEQDS  480
VLPASNRRQV GHLDYKKLYD EAYGKETTDS SDEEEWSGHS PNGNPEDSDT DSFAGPLKPA  540
KTRRARGGRQ NNERTPQSER HSGSVSEQHP EVLSNGTSST ARKKSYGPIV NQKLKAYFEK  600
EPYPSRPAKE SLAQELGLTF HQITRWFSST RHYSRVSAAK KGKRLENYTA ENNDGIAADS  660
IQQREPNGSV LGKPNVDRNG IVSEERMAQK NLDEGEREDT PFRQHIGCEQ TLDGTPPANK  720
HNTANSRNDT SRNAEDTPLG QDIGCEQTVA AVNQNCTIGS SNVGSPKGAP GGNKRLKNSP  780
RSVGSPRRGS AEKNIPGLEH VDEARRKAIL RELRKMKAAG R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115137KKKVPNEPVNDSTAAQPAARKRK
2133139ARKRKRG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.16e-81HB-PHD family protein