PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG040620.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 607aa    MW: 66362.8 Da    PI: 4.4257
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG040620.12genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.71.3e-103784171352
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        + L+++Fek++yps+ ++e LA++lgLt  q++ WF   R
  TRIDC3AG040620.12 378 QKLKAYFEKEPYPSRPAKESLAQELGLTFHQITRWFSSTR 417
                        78**********************************8776 PP

2PHD42.71.3e-142782151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD  1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51
                       +C++C +   + +++++lCdg C++ fH+kCl+++l  e++p+g   wlC+ C++k
  TRIDC3AG040620.12 27 FCAICASkhVTLKNDIILCDGvCDRGFHQKCLNPPLLAEDIPQGdeGWLCPACDCK 82
                       7******65555********77*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    
MDSLLLEGKL DESLFDSEGE ISSEDIFCAI CASKHVTLKN DIILCDGVCD RGFHQKCLNP  60
PLLAEDIPQG DEGWLCPACD CKLDCIDLLN ELQGSTLAMH DSWEKVFPES TSNGLNQIGA  120
SDLPSDDSEE DYDPTLAEGD TVDENKSSAE DGDEGSDSDD LDFITSSDES EPSKKKRSES  180
KNKNTVNDLA LPSDDSEDDD FDPEGPNSSE DQKTKTNSDE SDFTSDSDDF CAEISKSSGK  240
DKVSAPSFSD QTNGVDIMEA ELEQDSVLPA SNRRQVGHLD YKKLYDEAYG KETTDSSDEE  300
EWSGHSPNGN PEDSDTDSFA GPLKPAKTRR ARGGRQNNER TPQSERHSGS VSEQHPEVLS  360
NGTSSTARKK SYGPIVNQKL KAYFEKEPYP SRPAKESLAQ ELGLTFHQIT RWFSSTRHYS  420
RVSAAKKGKR LENYTAENND GIAADSIQQR EPNGSVLGKP NVDRNGIVSE ERMAQKNLDE  480
GEREDTPFRQ HIGCEQTLDG TPPANKHNTA NSRNDTSRNA EDTPLGQDIG CEQTVAAVNQ  540
NCTIGSSNVG SPKGAPGGNK RLKNSPRSVG SPRRGSAEKN IPGLEHVDEA RRKAILRELR  600
KMKAAGR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.17e-47HB-PHD family protein