PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG040620.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 833aa    MW: 91588.8 Da    PI: 6.5763
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG040620.11genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.11.9e-106046431352
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        + L+++Fek++yps+ ++e LA++lgLt  q++ WF   R
  TRIDC3AG040620.11 604 QKLKAYFEKEPYPSRPAKESLAQELGLTFHQITRWFSSTR 643
                        78**********************************8776 PP

2PHD42.12e-14241296151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C++C +   + +++++lCdg C++ fH+kCl+++l  e++p+g   wlC+ C++k
  TRIDC3AG040620.11 241 FCAICASkhVTLKNDIILCDGvCDRGFHQKCLNPPLLAEDIPQGdeGWLCPACDCK 296
                        7******65555********77*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 833 aa     Download sequence    
MGKTSASGVV QENEKVGNGS PSSPTKGKRG RKGSQIIANK KYPLRSAHSS TRVLRSTSKD  60
KSKTPNEPVS PLRSAHSSPR VLRSTPKNKS KTPKKQVNSL RSAHSSARVL SSTLKKKVPN  120
EPVNDSTAAQ PAARKRKRGR PSNAASPKNE CIKIRQRVRY ILNRMNYEQS FIQAYAGEGW  180
KGQSLEKIRP EKELERAKAE ILRCKLRIRE AFRNMDSLLL EGKLDESLFD SEGEISSEDI  240
FCAICASKHV TLKNDIILCD GVCDRGFHQK CLNPPLLAED IPQGDEGWLC PACDCKLDCI  300
DLLNELQGST LAMHDSWEKV FPESTSNGLN QIGASDLPSD DSEEDYDPTL AEGDTVDENK  360
SSAEDGDEGS DSDDLDFITS SDESEPSKKK RSESKNKNTV NDLALPSDDS EDDDFDPEGP  420
NSSEDQKTKT NSDESDFTSD SDDFCAEISK SSGKDKVSAP SFSDQTNGVD IMEAELEQDS  480
VLPASNRRQV GHLDYKKLYD VCLFLAFLRT INEAYGKETT DSSDEEEWSG HSPNGNPEDS  540
DTDSFAGPLK PAKTRRARGG RQNNERTPQS ERHSGSVSEQ HPEVLSNGTS STARKKSYGP  600
IVNQKLKAYF EKEPYPSRPA KESLAQELGL TFHQITRWFS STRHYSRVSA AKKGKRLENY  660
TAENNDGIAA DSIQQREPNG SVLGKPNVDR NGIVSEERMA QKNLDEGERE DTPFRQHIGC  720
EQTLDGTPPA NKHNTANSRN DTSRNAEDTP LGQDIGCEQT VAAVNQNCTI GSSNVGSPKG  780
APGGNKRLKN SPRSVGSPRR GSAEKNIPGL EHVDEARRKA ILRELRKMKA AGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115137KKKVPNEPVNDSTAAQPAARKRK
2133139ARKRKRG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.18e-81HB-PHD family protein