PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1126aa    MW: 124937 Da    PI: 4.5421
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.7e-106416811252
                       HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        e+L+++F  ++yps++ +e LA++lgLt  qV  WF   R
  TRIDC1BG056900.8 641 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVNKWFESTR 681
                       589**********************************8766 PP

2PHD39.41.4e-13293348151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.8 293 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 348
                       599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1126 aa     Download sequence    
ARKRPVVQCF ATDHRRLAGR RRTLARCWFI WCNYVQIHIL LRLRSARRQF SEAVFFLLLE  60
YKIISGRHQM DKSNTSGCAE DTIETRSYAN SSLNPEALKH QSFPFPYTSP SGERKNFKRA  120
ANRGRKGSRV LSSRTYPLKS SESTVRVLRS RSVADKSPSD SVQTPTEKAA KKPPSDSVDT  180
LVKPAAKRIK RDRPTKGGPD DELSKIRKRI RYILNRMNYH QSFLEAYASE GWKNQSLEKI  240
RPEKELERAK EEIVRCKLRI REAFQNLDHL LTVGKLEESL FDSEGKISSD DIVCATCSLQ  300
EATLNNDIIL CDGACDRGFH QNCLNPPLLT KDIPEGEEGW LCPACDCKID CIELINELQG  360
TDLDINDSWE KVFPEAAAVA HGPMQNDVAD LPSDDSEDDD FDPNISEEHV AGHAEGSSEE  420
DGDEGSDSDD SNFMTSSDNS EHVKEKVKVD DLGLPSEDSE DDDYDPAGPD SDKDIEEKQD  480
ESDFTSDSDE FCAEITKSCS KDEVSSGPKV GGRTNDLEGA PVRPNTSMSH SKDLEIDPDV  540
ILPSTKRQVQ RLDYKKLYDD TYGEAPSESS DGDEWSGKST LKEDNEERNE VDSFARKSSR  600
GTRAVHPDGF HGLVNDQHAG GLTSAGSNSK ANKRHFGPVI NERLNQYFTT DQYPSRAVKE  660
SLAQELGLTF HQVNKWFEST RHARAAAMKN GTQLEKQSNS RKKKSSDATH MEVKDQPNAC  720
KEEGIRQHSP VKQDTDGGQR THVPPESSQS YTKTSGLIGC PKSESRENHE KNTSSKYVGM  780
PTDGSAEDQI LELEPEDEGS DSDDLNFVTR SGNSEPLKNR EKIDDLGLPS AYSEDDDYDS  840
DEVIEMMQSS SDESNFTTSS DNPEDVKEKV DDLGLPSEDS EDDDYDPAGP GSDEDIGKKQ  900
SSSEKSHSSD KSENRKTKRK VDDLGLPSED SEDDDYDPAS PDSDKDIEEK QDESDFSSDS  960
DDFCVEIAKS CCGQEGVPSG AKVGADRTDD LEGTTICANA AISNLPSKDP EMDQYVVLPV  1020
SARQKVQSPD SKKLAAYGRA PSDSSYSEEL SKKGTPEKDK GKESEAGSFV RQSNEFTPQR  1080
SQQSFHGSVN GQNAEELLTP NGSSTTGQKR QYGPIINQVL WFNRTG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205211KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.16e-75HB-PHD family protein