PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1278aa    MW: 141805 Da    PI: 4.6817
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-106306701252
                       HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        e+L+++F  ++yps++ +e LA++lgLt  qV  WF   R
  TRIDC1BG056900.7 630 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVNKWFESTR 670
                       589**********************************8766 PP

2Homeobox34.43.6e-11110711471353
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53  
                        ++L e F+ ++yps++ +e LA++lgLt rqV  WF  rR 
  TRIDC1BG056900.7 1107 QRLHEQFKTDQYPSRAVKESLAQELGLTFRQVEKWFESRRR 1147
                        6899***********************************96 PP

3PHD39.21.6e-13282337151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.7 282 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 337
                       599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1278 aa     Download sequence    
TDHRRLAGRR RTLARCWFIW CNYVQIHILL RLRSARRQFS EAVFFLLLEY KIISGRHQMD  60
KSNTSGCAED TIETRSYANS SLNPEALKHQ SFPFPYTSPS GERKNFKRAA NRGRKGSRVL  120
SSRTYPLKSS ESTVRVLRSR SVADKSPSDS VQTPTEKAAK KPPSDSVDTL VKPAAKRIKR  180
DRPTKGGPDD ELSKIRKRIR YILNRMNYHQ SFLEAYASEG WKNQSLEKIR PEKELERAKE  240
EIVRCKLRIR EAFQNLDHLL TVGKLEESLF DSEGKISSDD IVCATCSLQE ATLNNDIILC  300
DGACDRGFHQ NCLNPPLLTK DIPEGEEGWL CPACDCKIDC IELINELQGT DLDINDSWEK  360
VFPEAAAVAH GPMQNDVADL PSDDSEDDDF DPNISEEHVA GHAEGSSEED GDEGSDSDDS  420
NFMTSSDNSE HVKEKVKVDD LGLPSEDSED DDYDPAGPDS DKDIEEKQDE SDFTSDSDEF  480
CAEITKSCSK DEVSSGPKVG GRTNDLEGAP VRPNTSMSHS KDLEIDPDVI LPSTKRQVQR  540
LDYKKLYDDT YGEAPSESSD GDEWSGKSTL KEDNEERNEV DSFARKSSRG TRAVHPDGFH  600
GLVNDQHAGG LTSAGSNSKA NKRHFGPVIN ERLNQYFTTD QYPSRAVKES LAQELGLTFH  660
QVNKWFESTR HARAAAMKNG TQLEKQSNSR KKKSSDATHM EVKDQPNACK EEGIRQHSPV  720
KQDTDGGQRT HVPPESSQSY TKTSGLIGCP KSESRENHEK NTSSKYVGMP TDGSAEDQIL  780
ELEPEDEGSD SDDLNFVTRS GNSEPLKNRE KIDDLGLPSA YSEDDDYDSD EVIEMMQSSS  840
DESNFTTSSD NPEDVKEKVD DLGLPSEDSE DDDYDPAGPG SDEDIGKKQS SSEKSHSSDK  900
SENRKTKRKV DDLGLPSEDS EDDDYDPASP DSDKDIEEKQ DESDFSSDSD DFCVEIAKSC  960
CGQEGVPSGA KVGADRTDDL EGTTICANAA ISNLPSKDPE MDQYVVLPVS ARQKVQSPDS  1020
KKLAAYGRAP SDSSYSEELS KKGTPEKDKG KESEAGSFVR QSNEFTPQRS QQSFHGSVNG  1080
QNAEELLTPN GSSTTGQKRQ YGPIINQRLH EQFKTDQYPS RAVKESLAQE LGLTFRQVEK  1140
WFESRRRHIR VASNKGSTHV ENHSTKENPN ECKSDALNED TPSGILNEGI TQDGPLKQDI  1200
GGGLKTNAST PNSSQRYTTP LVRRPKGESR ENHMKNTSSS SSGRPEGSDA GYAVLALEAL  1260
DEKIRSKMLQ ELKKRKIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194200KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.16e-75HB-PHD family protein