PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1054aa    MW: 116002 Da    PI: 4.3216
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.4e-104064461252
                       HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        e+L+++F  ++yps++ +e LA++lgLt  qV  WF   R
  TRIDC1BG056900.3 406 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVNKWFESTR 446
                       589**********************************8766 PP

2Homeobox34.72.9e-118839231353
                       HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++L e F+ ++yps++ +e LA++lgLt rqV  WF  rR 
  TRIDC1BG056900.3 883 QRLHEQFKTDQYPSRAVKESLAQELGLTFRQVEKWFESRRR 923
                       6899***********************************96 PP

3PHD39.51.3e-1358113151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.3  58 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 113
                       599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1054 aa     Download sequence    
SLEKIRPEKE LERAKEEIVR CKLRIREAFQ NLDHLLTVGK LEESLFDSEG KISSDDIVCA  60
TCSLQEATLN NDIILCDGAC DRGFHQNCLN PPLLTKDIPE GEEGWLCPAC DCKIDCIELI  120
NELQGTDLDI NDSWEKVFPE AAAVAHGPMQ NDVADLPSDD SEDDDFDPNI SEEHVAGHAE  180
GSSEEDGDEG SDSDDSNFMT SSDNSEHVKE KVKVDDLGLP SEDSEDDDYD PAGPDSDKDI  240
EEKQDESDFT SDSDEFCAEI TKSCSKDEVS SGPKVGGRTN DLEGAPVRPN TSMSHSKDLE  300
IDPDVILPST KRQVQRLDYK KLYDDTYGEA PSESSDGDEW SGKSTLKEDN EERNEVDSFA  360
RKSSRGTRAV HPDGFHGLVN DQHAGGLTSA GSNSKANKRH FGPVINERLN QYFTTDQYPS  420
RAVKESLAQE LGLTFHQVNK WFESTRHARA AAMKNGTQLE KQSNSRKKKS SDATHMEVKD  480
QPNACKEEGI RQHSPVKQDT DGGQRTHVPP ESSQSYTKTS GLIGCPKSES RENHEKNTSS  540
KYVGMPTDGS AEDQILELEP EDEGSDSDDL NFVTRSGNSE PLKNREKIDD LGLPSAYSED  600
DDYDSDEVIE MMQSSSDESN FTTSSDNPED VKEKVDDLGL PSEDSEDDDY DPAGPGSDED  660
IGKKQSSSEK SHSSDKSENR KTKRKVDDLG LPSEDSEDDD YDPASPDSDK DIEEKQDESD  720
FSSDSDDFCV EIAKSCCGQE GVPSGAKVGA DRTDDLEGTT ICANAAISNL PSKDPEMDQY  780
VVLPVSARQK VQSPDSKKLA AYGRAPSDSS YSEELSKKGT PEKDKGKESE AGSFVRQSNE  840
FTPQRSQQSF HGSVNGQNAE ELLTPNGSST TGQKRQYGPI INQRLHEQFK TDQYPSRAVK  900
ESLAQELGLT FRQVEKWFES RRRHIRVASN KGSTHVENHS TKENPNECKS DALNEDTPSG  960
ILNEGITQDG PLKQDIGGGL KTNASTPNSS QRYTTPLVRR PKGESRENHM KNTSSSSSGR  1020
PEGSDAGYAV LALEALDEKI RSKMLQELKK RKIG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-58HB-PHD family protein