PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1160aa    MW: 128864 Da    PI: 4.5235
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.12genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.84.9e-106266661252
                        HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         e+L+++F  ++yps++ +e LA++lgLt  qV  WF   R
  TRIDC1BG056900.12 626 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVNKWFESTR 666
                        589**********************************8766 PP

2Homeobox20.86.8e-07110311351345
                         HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
           Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVk 45  
                         ++L e F+ ++yps++ +e LA++lgLt rqV 
  TRIDC1BG056900.12 1103 QRLHEQFKTDQYPSRAVKESLAQELGLTFRQVC 1135
                         6899***************************95 PP

3PHD39.31.4e-13278333151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.12 278 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 333
                        599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1160 aa     Download sequence    
RLAGRRRTLA RCWFIWCNYV QIHILLRLRS ARRQFSEAVF FLLLEYKIIS GRHQMDKSNT  60
SGCAEDTIET RSYANSSLNP EALKHQSFPF PYTSPSGERK NFKRAANRGR KGSRVLSSRT  120
YPLKSSESTV RVLRSRSVAD KSPSDSVQTP TEKAAKKPPS DSVDTLVKPA AKRIKRDRPT  180
KGGPDDELSK IRKRIRYILN RMNYHQSFLE AYASEGWKNQ SLEKIRPEKE LERAKEEIVR  240
CKLRIREAFQ NLDHLLTVGK LEESLFDSEG KISSDDIVCA TCSLQEATLN NDIILCDGAC  300
DRGFHQNCLN PPLLTKDIPE GEEGWLCPAC DCKIDCIELI NELQGTDLDI NDSWEKVFPE  360
AAAVAHGPMQ NDVADLPSDD SEDDDFDPNI SEEHVAGHAE GSSEEDGDEG SDSDDSNFMT  420
SSDNSEHVKE KVKVDDLGLP SEDSEDDDYD PAGPDSDKDI EEKQDESDFT SDSDEFCAEI  480
TKSCSKDEVS SGPKVGGRTN DLEGAPVRPN TSMSHSKDLE IDPDVILPST KRQVQRLDYK  540
KLYDDTYGEA PSESSDGDEW SGKSTLKEDN EERNEVDSFA RKSSRGTRAV HPDGFHGLVN  600
DQHAGGLTSA GSNSKANKRH FGPVINERLN QYFTTDQYPS RAVKESLAQE LGLTFHQVNK  660
WFESTRHARA AAMKNGTQLE KQSNSRKKKS SDATHMEVKD QPNACKEEGI RQHSPVKQDT  720
DGGQRTHVPP ESSQSYTKTS GLIGCPKSES RENHEKNTSS KYVGMPTDGS AEDQILELEP  780
EDEGSDSDDL NFVTRSGNSE PLKNREKIDD LGLPSAYSED DDYDSDEVIE MMQSSSDESN  840
FTTSSDNPED VKEKVDDLGL PSEDSEDDDY DPAGPGSDED IGKKQSSSEK SHSSDKSENR  900
KTKRKVDDLG LPSEDSEDDD YDPASPDSDK DIEEKQDESD FSSDSDDFCV EIAKSCCGQE  960
GVPSGAKVGA DRTDDLEGTT ICANAAISNL PSKDPEMDQY VVLPVSARQK VQSPDSKKLA  1020
AYGRAPSDSS YSEELSKKGT PEKDKGKESE AGSFVRQSNE FTPQRSQQSF HGSVNGQNAE  1080
ELLTPNGSST TGQKRQYGPI INQRLHEQFK TDQYPSRAVK ESLAQELGLT FRQVCTSFFH  1140
EFPCMYSCLG IEQNPHYGLC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190196KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.19e-75HB-PHD family protein