PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 939aa    MW: 103484 Da    PI: 4.1848
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.11genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.23.8e-104054451252
                        HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         e+L+++F  ++yps++ +e LA++lgLt  qV  WF   R
  TRIDC1BG056900.11 405 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVNKWFESTR 445
                        589**********************************8766 PP

2Homeobox21.15.3e-078829141345
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
           Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVk 45 
                        ++L e F+ ++yps++ +e LA++lgLt rqV 
  TRIDC1BG056900.11 882 QRLHEQFKTDQYPSRAVKESLAQELGLTFRQVC 914
                        6899***************************95 PP

3PHD39.71.1e-1357112151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.11  57 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 112
                        599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    
LEKIRPEKEL ERAKEEIVRC KLRIREAFQN LDHLLTVGKL EESLFDSEGK ISSDDIVCAT  60
CSLQEATLNN DIILCDGACD RGFHQNCLNP PLLTKDIPEG EEGWLCPACD CKIDCIELIN  120
ELQGTDLDIN DSWEKVFPEA AAVAHGPMQN DVADLPSDDS EDDDFDPNIS EEHVAGHAEG  180
SSEEDGDEGS DSDDSNFMTS SDNSEHVKEK VKVDDLGLPS EDSEDDDYDP AGPDSDKDIE  240
EKQDESDFTS DSDEFCAEIT KSCSKDEVSS GPKVGGRTND LEGAPVRPNT SMSHSKDLEI  300
DPDVILPSTK RQVQRLDYKK LYDDTYGEAP SESSDGDEWS GKSTLKEDNE ERNEVDSFAR  360
KSSRGTRAVH PDGFHGLVND QHAGGLTSAG SNSKANKRHF GPVINERLNQ YFTTDQYPSR  420
AVKESLAQEL GLTFHQVNKW FESTRHARAA AMKNGTQLEK QSNSRKKKSS DATHMEVKDQ  480
PNACKEEGIR QHSPVKQDTD GGQRTHVPPE SSQSYTKTSG LIGCPKSESR ENHEKNTSSK  540
YVGMPTDGSA EDQILELEPE DEGSDSDDLN FVTRSGNSEP LKNREKIDDL GLPSAYSEDD  600
DYDSDEVIEM MQSSSDESNF TTSSDNPEDV KEKVDDLGLP SEDSEDDDYD PAGPGSDEDI  660
GKKQSSSEKS HSSDKSENRK TKRKVDDLGL PSEDSEDDDY DPASPDSDKD IEEKQDESDF  720
SSDSDDFCVE IAKSCCGQEG VPSGAKVGAD RTDDLEGTTI CANAAISNLP SKDPEMDQYV  780
VLPVSARQKV QSPDSKKLAA YGRAPSDSSY SEELSKKGTP EKDKGKESEA GSFVRQSNEF  840
TPQRSQQSFH GSVNGQNAEE LLTPNGSSTT GQKRQYGPII NQRLHEQFKT DQYPSRAVKE  900
SLAQELGLTF RQVCTSFFHE FPCMYSCLGI EQNPHYGLC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-57HB-PHD family protein