PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1BG056900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 662aa    MW: 74025.5 Da    PI: 4.7619
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1BG056900.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox222.8e-076256581245
                       HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
          Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVk 45 
                        e+L+++F  ++yps++ +e LA++lgLt  qV+
  TRIDC1BG056900.1 625 NERLNQYFTTDQYPSRAVKESLAQELGLTFHQVR 658
                       589****************************997 PP

2PHD40.37.2e-14277332151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   ++ +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1BG056900.1 277 VCATCSLqeATLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 332
                       599999854555********66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    
LAGRRRTLAR CWFIWCNYVQ IHILLRLRSA RRQFSEAVFF LLLEYKIISG RHQMDKSNTS  60
GCAEDTIETR SYANSSLNPE ALKHQSFPFP YTSPSGERKN FKRAANRGRK GSRVLSSRTY  120
PLKSSESTVR VLRSRSVADK SPSDSVQTPT EKAAKKPPSD SVDTLVKPAA KRIKRDRPTK  180
GGPDDELSKI RKRIRYILNR MNYHQSFLEA YASEGWKNQS LEKIRPEKEL ERAKEEIVRC  240
KLRIREAFQN LDHLLTVGKL EESLFDSEGK ISSDDIVCAT CSLQEATLNN DIILCDGACD  300
RGFHQNCLNP PLLTKDIPEG EEGWLCPACD CKIDCIELIN ELQGTDLDIN DSWEKVFPEA  360
AAVAHGPMQN DVADLPSDDS EDDDFDPNIS EEHVAGHAEG SSEEDGDEGS DSDDSNFMTS  420
SDNSEHVKEK VKVDDLGLPS EDSEDDDYDP AGPDSDKDIE EKQDESDFTS DSDEFCAEIT  480
KSCSKDEVSS GPKVGGRTND LEGAPVRPNT SMSHSKDLEI DPDVILPSTK RQVQRLDYKK  540
LYDDTYGEAP SESSDGDEWS GKSTLKEDNE ERNEVDSFAR KSSRGTRAVH PDGFHGLVND  600
QHAGGLTSAG SNSKANKRHF GPVINERLNQ YFTTDQYPSR AVKESLAQEL GLTFHQVRMS  660
LS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-77HB-PHD family protein