PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG050040.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1050aa    MW: 115410 Da    PI: 4.3269
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG050040.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.81.2e-10399445652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        f +   e+L+++F  ++yp+++ +e LA++lgLt rqV  WF   R
  TRIDC1AG050040.8 399 HFGPVINERLNQYFTTDQYPTRAVKESLAQELGLTFRQVNKWFESTR 445
                       566666789**********************************8766 PP

2Homeobox36.11.1e-118799191353
                       HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++L e F+ n+yps++ +e LA++lgLt rqV  WF  rR 
  TRIDC1AG050040.8 879 QRLHEQFKTNQYPSRAVKESLAQELGLTFRQVEKWFESRRR 919
                       6899***********************************96 PP

3PHD38.92e-1357112151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+    + +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1AG050040.8  57 VCATCSLqdVTLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 112
                       5999998544459*******66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1050 aa     Download sequence    
LEKIRPEKEL ERAKAEIVRC KLRIREAFQN LDHLLTVGKL EESLFDSEGK ISSDDIVCAT  60
CSLQDVTLNN DIILCDGACD RGFHQNCLNP PLLTKDIPEG EEGWLCPACD CKIDCIELIN  120
ELQGTDLDIN DSWEKVFPEA AAVAHGSMQN DVADLPSDDS EDDDFDPNIP EEHVAGHAEG  180
SSEEDGDEGS DSDDSNFMTS SDNSEHVKEK EKVDDLGLPS EDSEDDDYDP AGPDSDKDIE  240
EKQDESDFTS DSDDFCAEIM KSCSKDEVSS GPKVGGRTND LEGAPVRPNT SMSHTKDLEI  300
DQDVILPSTK RQVQRLDYKK LYDDTYGEAP SESSDGDDWS GKSTLKEDNE EGNEVDSFAR  360
KSPRGTRVVH PDGFHGLVNE QHAGGLTSDG SNSKAKKRHF GPVINERLNQ YFTTDQYPTR  420
AVKESLAQEL GLTFRQVNKW FESTRHARAA AMKNGAQLEK HSNSRKKKSS DQPNACKEEG  480
IRQDSPVKQE TDGGQRAHMP PESSQSYTKT SGLAGCPKSE SRENHEKNTP LKYVGMPTDG  540
SAEDQILGLE PEDDGSDSDD PNFAIRSGNS EPSKNREKVD DLGLPSAYSE DDDYDSDEVI  600
EMMQSSSDES DSNESNFTTS SDNPEDVKEK VDDIGLPSED SEDDDYDPAG PGSHEDIGKN  660
QSSSDKSHSS DKSENRKTKR KADDLGLPSE DSEDDDYDPA SPDSDKDIEE KQDESDFSSD  720
CDDFCVEIAK SCCGQEGVPS GAKVGGDRTD DLEGTTICAN AAISNLPSKD PEMDQYVVLP  780
VSARQKVQSP DSKKLAAYGK ASSDSSYGEE LSKKCTPEKD NGKESEAGSF VRQSNEFTPQ  840
RSQQSFHGSV NGQNAEELLT PNGSSTTGQK RQYGPIINQR LHEQFKTNQY PSRAVKESLA  900
QELGLTFRQV EKWFESRRRH IRVASNKSST HVENHSTKEN PNVCKRDAVN EDTPSGSLNE  960
GITQDGPLKQ DIGGGLRTNA SPPNSSQRYT TPLVRRPKGE SRENHMKNTS SSSAGRPKGS  1020
DAGYAVLALE AFDEKTRSKM LQELKKRKIG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.17e-59HB-PHD family protein