PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG050040.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1278aa    MW: 141429 Da    PI: 4.6412
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG050040.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.51.5e-10627673652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        f +   e+L+++F  ++yp+++ +e LA++lgLt rqV  WF   R
  TRIDC1AG050040.3 627 HFGPVINERLNQYFTTDQYPTRAVKESLAQELGLTFRQVNKWFESTR 673
                       566666789**********************************8766 PP

2Homeobox35.71.4e-11110711471353
                        HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53  
                        ++L e F+ n+yps++ +e LA++lgLt rqV  WF  rR 
  TRIDC1AG050040.3 1107 QRLHEQFKTNQYPSRAVKESLAQELGLTFRQVEKWFESRRR 1147
                        6899***********************************96 PP

3PHD38.62.5e-13285340151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+    + +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1AG050040.3 285 VCATCSLqdVTLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 340
                       5999998544459*******66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1278 aa     Download sequence    
TDHRRLSGRR RTPARCWFIC ATTYRSIFCC DCTLQEDNFP KPSSFFLLEY KIISGRHQMD  60
KSNTSGCAAE DIIETRNYAN SSLNPEALKH QSFPFPYTSL SGERKNFKRA ANRGKKGSRV  120
LSSRTYPLKS SESTVRVLRS RSVADKSPSD AVQTSTERAA KKPPSDSVDT LVKPAAKRIK  180
RDRDRPTKGG PDDELSKIRK RIRYILNRMN YHQSFLEAYA SEGWKNQSLE KIRPEKELER  240
AKAEIVRCKL RIREAFQNLD HLLTVGKLEE SLFDSEGKIS SDDIVCATCS LQDVTLNNDI  300
ILCDGACDRG FHQNCLNPPL LTKDIPEGEE GWLCPACDCK IDCIELINEL QGTDLDINDS  360
WEKVFPEAAA VAHGSMQNDV ADLPSDDSED DDFDPNIPEE HVAGHAEGSS EEDGDEGSDS  420
DDSNFMTSSD NSEHVKEKEK VDDLGLPSED SEDDDYDPAG PDSDKDIEEK QDESDFTSDS  480
DDFCAEIMKS CSKDEVSSGP KVGGRTNDLE GAPVRPNTSM SHTKDLEIDQ DVILPSTKRQ  540
VQRLDYKKLY DDTYGEAPSE SSDGDDWSGK STLKEDNEEG NEVDSFARKS PRGTRVVHPD  600
GFHGLVNEQH AGGLTSDGSN SKAKKRHFGP VINERLNQYF TTDQYPTRAV KESLAQELGL  660
TFRQVNKWFE STRHARAAAM KNGAQLEKHS NSRKKKSSDQ PNACKEEGIR QDSPVKQETD  720
GGQRAHMPPE SSQSYTKTSG LAGCPKSESR ENHEKNTPLK YVGMPTDGSA EDQILGLEPE  780
DDGSDSDDPN FAIRSGNSEP SKNREKVDDL GLPSAYSEDD DYDSDEVIEM MQSSSDESDS  840
NESNFTTSSD NPEDVKEKVD DIGLPSEDSE DDDYDPAGPG SHEDIGKNQS SSDKSHSSDK  900
SENRKTKRKA DDLGLPSEDS EDDDYDPASP DSDKDIEEKQ DESDFSSDCD DFCVEIAKSC  960
CGQEGVPSGA KVGGDRTDDL EGTTICANAA ISNLPSKDPE MDQYVVLPVS ARQKVQSPDS  1020
KKLAAYGKAS SDSSYGEELS KKCTPEKDNG KESEAGSFVR QSNEFTPQRS QQSFHGSVNG  1080
QNAEELLTPN GSSTTGQKRQ YGPIINQRLH EQFKTNQYPS RAVKESLAQE LGLTFRQVEK  1140
WFESRRRHIR VASNKSSTHV ENHSTKENPN VCKRDAVNED TPSGSLNEGI TQDGPLKQDI  1200
GGGLRTNASP PNSSQRYTTP LVRRPKGESR ENHMKNTSSS SAGRPKGSDA GYAVLALEAF  1260
DEKTRSKMLQ ELKKRKIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197203KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-76HB-PHD family protein