PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG050040.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 1156aa    MW: 128051 Da    PI: 4.442
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG050040.11genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.71.3e-10619665652
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         f +   e+L+++F  ++yp+++ +e LA++lgLt rqV  WF   R
  TRIDC1AG050040.11 619 HFGPVINERLNQYFTTDQYPTRAVKESLAQELGLTFRQVNKWFESTR 665
                        566666789**********************************8766 PP

2Homeobox22.42.1e-07109911311345
                         HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
           Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVk 45  
                         ++L e F+ n+yps++ +e LA++lgLt rqV 
  TRIDC1AG050040.11 1099 QRLHEQFKTNQYPSRAVKESLAQELGLTFRQVC 1131
                         6899***************************95 PP

3PHD38.82.2e-13277332151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ C+    + +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1AG050040.11 277 VCATCSLqdVTLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 332
                        5999998544459*******66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1156 aa     Download sequence    
RRRTPARCWF ICATTYRSIF CCDCTLQEDN FPKPSSFFLL EYKIISGRHQ MDKSNTSGCA  60
AEDIIETRNY ANSSLNPEAL KHQSFPFPYT SLSGERKNFK RAANRGKKGS RVLSSRTYPL  120
KSSESTVRVL RSRSVADKSP SDAVQTSTER AAKKPPSDSV DTLVKPAAKR IKRDRDRPTK  180
GGPDDELSKI RKRIRYILNR MNYHQSFLEA YASEGWKNQS LEKIRPEKEL ERAKAEIVRC  240
KLRIREAFQN LDHLLTVGKL EESLFDSEGK ISSDDIVCAT CSLQDVTLNN DIILCDGACD  300
RGFHQNCLNP PLLTKDIPEG EEGWLCPACD CKIDCIELIN ELQGTDLDIN DSWEKVFPEA  360
AAVAHGSMQN DVADLPSDDS EDDDFDPNIP EEHVAGHAEG SSEEDGDEGS DSDDSNFMTS  420
SDNSEHVKEK EKVDDLGLPS EDSEDDDYDP AGPDSDKDIE EKQDESDFTS DSDDFCAEIM  480
KSCSKDEVSS GPKVGGRTND LEGAPVRPNT SMSHTKDLEI DQDVILPSTK RQVQRLDYKK  540
LYDDTYGEAP SESSDGDDWS GKSTLKEDNE EGNEVDSFAR KSPRGTRVVH PDGFHGLVNE  600
QHAGGLTSDG SNSKAKKRHF GPVINERLNQ YFTTDQYPTR AVKESLAQEL GLTFRQVNKW  660
FESTRHARAA AMKNGAQLEK HSNSRKKKSS DQPNACKEEG IRQDSPVKQE TDGGQRAHMP  720
PESSQSYTKT SGLAGCPKSE SRENHEKNTP LKYVGMPTDG SAEDQILGLE PEDDGSDSDD  780
PNFAIRSGNS EPSKNREKVD DLGLPSAYSE DDDYDSDEVI EMMQSSSDES DSNESNFTTS  840
SDNPEDVKEK VDDIGLPSED SEDDDYDPAG PGSHEDIGKN QSSSDKSHSS DKSENRKTKR  900
KADDLGLPSE DSEDDDYDPA SPDSDKDIEE KQDESDFSSD CDDFCVEIAK SCCGQEGVPS  960
GAKVGGDRTD DLEGTTICAN AAISNLPSKD PEMDQYVVLP VSARQKVQSP DSKKLAAYGK  1020
ASSDSSYGEE LSKKCTPEKD NGKESEAGSF VRQSNEFTPQ RSQQSFHGSV NGQNAEELLT  1080
PNGSSTTGQK RQYGPIINQR LHEQFKTNQY PSRAVKESLA QELGLTFRQV CTSFFHEFPC  1140
MYSCLGIEQN PHYGFC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.17e-76HB-PHD family protein