PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC1AG050040.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-PHD
Protein Properties Length: 670aa    MW: 74897.3 Da    PI: 4.6743
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC1AG050040.10genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.97e-08627666645
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
           Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                         f +   e+L+++F  ++yp+++ +e LA++lgLt rqV+
  TRIDC1AG050040.10 627 HFGPVINERLNQYFTTDQYPTRAVKESLAQELGLTFRQVR 666
                        566666789******************************7 PP

2PHD39.71.1e-13285340151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ C+    + +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  TRIDC1AG050040.10 285 VCATCSLqdVTLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 340
                        5999998544459*******66*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    
TDHRRLSGRR RTPARCWFIC ATTYRSIFCC DCTLQEDNFP KPSSFFLLEY KIISGRHQMD  60
KSNTSGCAAE DIIETRNYAN SSLNPEALKH QSFPFPYTSL SGERKNFKRA ANRGKKGSRV  120
LSSRTYPLKS SESTVRVLRS RSVADKSPSD AVQTSTERAA KKPPSDSVDT LVKPAAKRIK  180
RDRDRPTKGG PDDELSKIRK RIRYILNRMN YHQSFLEAYA SEGWKNQSLE KIRPEKELER  240
AKAEIVRCKL RIREAFQNLD HLLTVGKLEE SLFDSEGKIS SDDIVCATCS LQDVTLNNDI  300
ILCDGACDRG FHQNCLNPPL LTKDIPEGEE GWLCPACDCK IDCIELINEL QGTDLDINDS  360
WEKVFPEAAA VAHGSMQNDV ADLPSDDSED DDFDPNIPEE HVAGHAEGSS EEDGDEGSDS  420
DDSNFMTSSD NSEHVKEKEK VDDLGLPSED SEDDDYDPAG PDSDKDIEEK QDESDFTSDS  480
DDFCAEIMKS CSKDEVSSGP KVGGRTNDLE GAPVRPNTSM SHTKDLEIDQ DVILPSTKRQ  540
VQRLDYKKLY DDTYGEAPSE SSDGDDWSGK STLKEDNEEG NEVDSFARKS PRGTRVVHPD  600
GFHGLVNEQH AGGLTSDGSN SKAKKRHFGP VINERLNQYF TTDQYPTRAV KESLAQELGL  660
TFRQVRMSLS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197203KIRKRIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-78HB-PHD family protein