PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RcHm_v2.0_Chr6g0254411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family HB-PHD
Protein Properties Length: 1207aa    MW: 131916 Da    PI: 4.4771
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RcHm_v2.0_Chr6g0254411genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox406.5e-1310531096952
                              HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                Homeobox    9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52  
                              +  +++L + F++n+yp+++++e+LA++lg+  +qV+ WF N R
  RcHm_v2.0_Chr6g0254411 1053 EAVTQQLYASFKENQYPDRSMKERLAQELGVMAKQVSKWFENAR 1096
                              56789*************************************99 PP

2PHD39.41.4e-13677732151
                             SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                     PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                             +C+ Cg+    ++++++lCdg C++ fH++Cl+++l see+p +   wlC+ C++k
  RcHm_v2.0_Chr6g0254411 677 FCAKCGSkdVYADNDIILCDGaCDRGFHQYCLEPPLLSEEIPPDdeGWLCPGCDCK 732
                             6999**964445********66*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1207 aa     Download sequence    
MADAAPLDIP LECVSSQTAK CQEESTSGQT HDIGSESGFS EPTKQKIGCD VLQNELQEIC  60
NASNDDDQSQ SFGNLTEKSH PEQLGLPPEA VSNISQGAAV NILTKSAHGH PSTCENIQNG  120
PLQIRTALSS CTTSDHLQSF SGNVTKNSLA EKLELPCEEP HEDLGCQTGK TSCSEQISLE  180
QRNDFGFGTR EEKQHIGSDI VQNEIIQTII PVSSCGNEQL QFISETVNTT FPNEQVGVPP  240
EDVSKTLEPT NNFGFETQSS ELAEDKQHCG SDVPQNEGLQ SCDGNEPLQS FCENMNTSSL  300
NEQAVLPCEG VKKTLEQTNN VNSGTSYSEP AEENQNLGSD FVQDEPLQTI IPVASCGGNE  360
QLQVVNEVAS VTSLSEQVGL PLEAVSKTCQ TEKLSCYLQT ASDQINESGS GSVPCEPQEQ  420
RDQLGLLPSQ NDQVKTCTAV SSSIVSEQSG PSVEEMKNSV IGHLEPPLED ASKDHTDELI  480
KPHMNNVPQN SSLDPSETAS ENASKISSQI GCKDKRNSSS RQKSRSLVSS DRVLRSRTVE  540
KPEAPELSNN VATLESSNSV ANVSNEKEGK RQKRKKKHRE RVAADEFSRI RSHLRYFLNR  600
INYEKSLIDA YSGEGWKGNS LEKIRPEKEL QRATSEILRR KLKIRDLFQR LDSLCAEGMF  660
PESLFDSDGQ IDSEDIFCAK CGSKDVYADN DIILCDGACD RGFHQYCLEP PLLSEEIPPD  720
DEGWLCPGCD CKVDCIDLLN DSQGTDLSIT DSWEKVFPEA AVAASAGQHQ ENNQGLLSDD  780
SDDNDYDPDG PETDEEVQEA ESSSDESEYA SASDGLETPK TNDEQYLGLP SDDSEDDDFN  840
PDAPDPTEDV KQDSSSSDFT SDSEDLEAVL DEDNKSFENG EGPQSSLLEG SMLLRGSGEK  900
SSKRGQKRHS IKDEISSLLE SDPGQDGSTP VSGKRHVERL DYKKLHDEEY GNIPTSDDED  960
YNETAAPRKR KKGTGQVSPA SLKGKPSTIK NGVTSKDIKD DPDKNEHTPR RTPRRKSSAK  1020
DNSSSPNESL KSSPKSGSTS GRARASKYKR LGEAVTQQLY ASFKENQYPD RSMKERLAQE  1080
LGVMAKQVSK WFENARHCVK AGLAVPQAMR KQPNQAETNI RDADHDGTQK NESPRTDDAV  1140
AGCCSQDVKD NKSATPKSSR AKTSTPKGRK RKSRLDPGGS DLDEKFKTPP ETSSKGGRVT  1200
RRRKSVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1968972RKRKK
211681175GRKRKSRL
312001205TRRRKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.15e-89HB-PHD family protein