PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RcHm_v2.0_Chr4g0399601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rosa
Family HB-PHD
Protein Properties Length: 699aa    MW: 78418.4 Da    PI: 9.6433
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RcHm_v2.0_Chr4g0399601genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.41.6e-10473517953
                             HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                             ++ +e L ++F +n  ps++ +  L+k+lgL+ ++V+ WF+N R+
  RcHm_v2.0_Chr4g0399601 473 RNAVEKLRQVFSENELPSKAVKDNLSKELGLDPEKVSKWFKNTRY 517
                             578899*************************************97 PP

2PHD39.81e-13232287151
                             SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                     PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                             +C+ C+ +++  ++++vlCd +C+ +fH+kCl+++l++e++p+g   w+C+ C++k
  RcHm_v2.0_Chr4g0399601 232 FCAKCKLNEAfpDNDIVLCDgTCNAAFHQKCLDPPLDTENIPRGdqGWFCKFCECK 287
                             699999955455********56*********************999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    
MRGLGKKSSV QESGKSHYST PLSKLLSSAK FKKGGKVSHV KKVKPKSKTT IASSLLKRRS  60
ADSSRKGTKN NDTSKKLTTR KGLHKACDAD YSNKSSSVKL QNEKFSKDGS DEKGENADGE  120
TRIRKRRRKK KSKKNKVDVD ETARLQRRTR YLLIKIKLEQ NLIDAYSGEG WKGQSREKIK  180
PEKELQRAEN QILKCKLGIR DAIHQLHSLG SVGSIADSVI DPDGSVYHEH IFCAKCKLNE  240
AFPDNDIVLC DGTCNAAFHQ KCLDPPLDTE NIPRGDQGWF CKFCECKMEI LEVVNAHLGT  300
CFSMDSTWQD VFKEEAAFPD GGNLLLNPDE EWPSDESDDD DYNPDRNVNS CSISREGSDE  360
NVSDDELSTD GSVGSDESTD GDIVSGRRQR SSVDYKKLYD EMFGKEGPVL EQVSDDEDWG  420
PGKRKRREKE SDAASTLMTL YESERNPDAV PTEVKSKPTT DTHVRRSCFR IPRNAVEKLR  480
QVFSENELPS KAVKDNLSKE LGLDPEKVSK WFKNTRYLAL KTRKAEGTKN LHTSASEINK  540
ESRYENVTGK AVDLMASDFE DASTETVVHS PRNIKKSFRR KHPKSLSSTQ KKNQQKGSSC  600
LSPAKSNKDG MELSDDVSLK KLLKGRTKEK RANIIAGSGG ESQVAELEME RLCKAKGRLE  660
NMRQKLLKFQ IAKAKKSKKP PPHEQSVIYV PVAELKEKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124128RKRRR
2124130RKRRRKK
3124131RKRRRKKK
4125131RKRRRKK
5126134RRRKKKSKK
6127157RRKKKSKKNKVDVDETARLQRRTRYLLIKIK
7128158RRKKKSKKNKVDVDETARLQRRTRYLLIKIK
8424429RKRREK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-154HB-PHD family protein