PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM86751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 424aa    MW: 46087.1 Da    PI: 6.3991
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM86751.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.51.9e-073744062254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +yp++e++++L +++gL+ +q+ +WF N+R +
  OWM86751.1 374 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 406
                 69*****************************87 PP

2ELK28.82.8e-10327348122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  OWM86751.1 327 ELKHELKQGYKEKIVDIREEIL 348
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    
MAFHNHQLTA QDLSSLHHFS DHPETPTSAS AADPHHPAPN WLNSALLRAQ QTPHSAAQFS  60
PSAPAPAPAD GSSNFLNLHT AAATGDSTPT HPHPHHQWLS RHQSLQGVPA PADSIVSGGG  120
AEHPSSDNTK SEGAAAGVES GGGGGAGAAA EGPVNWQNAR YKAEILGHPL YGQLLSAHVA  180
CLRIATPVDQ LPRIDAQLAQ SQQVVAKYSG LGGAGQGMVS DDEELDQFMT HYVLLLCSFK  240
EQLQQHVRVH AMEAVMACWE IEQSLQSLTG VSPGEGTGAT MSDDEDDPVD SDTNLFDGSL  300
DGTDSLGFGP LIPTESERSL MERVRQELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT  360
TSVLKSWWQT HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSSSTVMKS  420
KRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1404424RKRNWHSNPSSSTVMKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-179TALE family protein