PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM86577.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 479aa    MW: 53814.6 Da    PI: 6.737
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM86577.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.71.9e-083964341854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  OWM86577.1 396 MFQNflHPYPKDAEKHLLALKSGLTRSQVSNWFINARVR 434
                 5887779******************************88 PP

2BELL82.84.3e-27265333372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +e++ +k++Ll+ll+ Vd+rY+q+ ++++tvis+F+a+++l++ k++t++Al++iS  +++L+++i+++i
  OWM86577.1 265 REIEGRKTQLLNLLQAVDDRYNQCLDEIHTVISAFHAATELDP-KMHTRFALQTISILYKNLRERISSHI 333
                 79999**************************************.***********************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    
MAGFPVTPTL QGQPISDLQG QFHVNPDLSI SSLGRNFIGN SSHRSSVQEF PADMPIPASA  60
LATFLNARHE NSSLNLIEAS SSSFGTCGYE DIAGPSKWDF YKNNVPAPEL GTRACTFPGN  120
LDPNGWWVSS EGMNIRPGNP YFSPNPTREL SLSLGTSQPS AISSANVMDQ QSEISNNEMV  180
DQTSCDSQDI SLQFRPYRPM QFWELISGSK YLGAIQEILA QVASYALENL DSVSYLSGGL  240
GAGISNTVSS SCQDVFMVEP VGKVREIEGR KTQLLNLLQA VDDRYNQCLD EIHTVISAFH  300
AATELDPKMH TRFALQTISI LYKNLRERIS SHILSMGERE CLDYLGGSSS ERERSLEASL  360
VQRQWALQQL KRKDHQLWRP QRGLPEKSVS VLRAWMFQNF LHPYPKDAEK HLLALKSGLT  420
RSQVSNWFIN ARVRLWKPMI EEMYAELNRR KAHRGDEEER AEIFNRSCSS ISSRRFRIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-103TALE family protein