PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM85581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 271aa    MW: 30882.2 Da    PI: 5.9795
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM85581.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-091992332155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps++++  LA+++gL+++q+ +WF N+R ++
  OWM85581.1 199 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 233
                 569*****************************885 PP

2ELK39.41.3e-13153174122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +Ll+KYsgyLgsLkqEF+
  OWM85581.1 153 ELKSRLLQKYSGYLGSLKQEFM 174
                 9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    
MAHPHYPRLL AAYVNCQKVG APPEVVARLE EACSAAAAMG GGAGSGCIGE DPALDQFMEA  60
YCEMLTKYEQ ELSKPFKEAM LFLQRIESQF RALTLASSEP DISKLLSPSM EQAQILFLSS  120
FAIFSDGMDR NGSSEEEVDV NNSFIDPQAE DRELKSRLLQ KYSGYLGSLK QEFMKKRKKG  180
KLPKEARQQL LDWWTRHYKW PYPSESQKLA LAESTGLDQK QINNWFINQR KRHWKPSEDM  240
QFVVMDATHP HYYMDNVLGN PFPMDISPSI L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169178LKQEFMKKRK
2175179KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-128TALE family protein