PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM84592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 217aa    MW: 24287.6 Da    PI: 9.4414
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM84592.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14e-101101471954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OWM84592.1 110 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 147
                 665559******************************98 PP

2BELL62.77.8e-211413272
        BELL 32 tvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                +v++sF+ v+g gsa pYt+lA+ka+SrhFrcLkdaia q+
  OWM84592.1  1 MVVNSFDLVMGFGSAVPYTALAQKAMSRHFRCLKDAIAAQL 41
                79************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    
MVVNSFDLVM GFGSAVPYTA LAQKAMSRHF RCLKDAIAAQ LKLSYELLGE KDGAGTSGIT  60
KGETPKLKII DQSFRQPRAF HQMGMMEQEA WRPQRGLPER SVNILRAWLF EHFLHPYPSD  120
ADKHLLARQT GLSRNQVSNW FINARVRLWK PMVEEMYLQE AKEVEGDETE RDKNPSSSTT  180
TAAVHPLQAP ATSKRPNASA AETDPSLPTP ASRHSLS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-102TALE family protein