PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM82585.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 698aa    MW: 75172.9 Da    PI: 8.1664
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM82585.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093974341954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OWM82585.1 397 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 434
                 664459******************************88 PP

2BELL122.71.5e-39261332172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqe+q+kkakL+++l+eV++rY+qy++q+++vissFe+vag+gsak Yt+lAl++iS++FrcLkdaia qi
  OWM82585.1 261 ERQEIQMKKAKLINMLDEVEQRYRQYHNQMRIVISSFEQVAGIGSAKTYTALALQTISKQFRCLKDAIACQI 332
                 79*******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    
MATYFHQNSD IQAPDGLQTL VLMNPSYVQY SADAPPGGSG NFVFLNSAAA ATASTSHLAH  60
MPQPSQQLVG IPLPTSATTT TASQDHRSTV HVQHEISPLH GLIPRLQYNL WNPVDPSAAA  120
RETPRPSHSQ QGGLSLSLSS QQPPGFRSFR NEREPPQPAA SGGGGGGSPS SASASGVTNN  180
GGGVPGFQGM LLSSKYLKAA QELLDEVVNV GGGMNKADTS KKASSSGQSK ATGGSSSSAV  240
AAAGKEDGSG KSNMAELSTA ERQEIQMKKA KLINMLDEVE QRYRQYHNQM RIVISSFEQV  300
AGIGSAKTYT ALALQTISKQ FRCLKDAIAC QIKAANKSLG EEDSPGCKIE GSRLKFVDHQ  360
IRQQRALQQL GMIQHNAWRP QRGLPERSVS ILRAWLFEHF LHPYPKDSDK HMLAKQTGLT  420
RSQVSNWFIN ARVRLWKPMV EEMYVEEMKE QENNGMDERT TSKSIGPNED SALKSSSPQD  480
KGHSSENMSS KSFKSKETNS MTQDAQAIST NSASSIGESL RAPPGFTLIG SSELEGIAQV  540
SPKKPRSTEM LHSPTNVSSL EDQVTLKFGD ERAQSRDGYS IMGAPANFIG GFGQYPMGEI  600
GRFGAEQFVP SPTFTGNGVS LTLGLPHTEN LSLSIDHHQA FLPSQSIHLG RRVEVGEGNE  660
FGAINSSIPP PHSSTAYESI NIQNRKRFAA QLLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-145TALE family protein