PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM79030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 700aa    MW: 76343.2 Da    PI: 8.184
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM79030.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.7e-104104471954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  OWM79030.1 410 FEHflHPYPKDSDKQTLAKQTGLTRSQVSNWFINARVR 447
                 554459******************************88 PP

2BELL114.94.1e-37270341172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqe+q+kkakL+++l+eV++rY+qy++ +q+v++sFe++ g+gsa++YtslAlk+iS++FrcL+daia+q+
  OWM79030.1 270 ERQEVQMKKAKLMTMLDEVEQRYRQYHHHMQVVVASFEQALGVGSARSYTSLALKTISKQFRCLRDAIAGQV 341
                 79*******************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    
MAAYFQHNSE SQAGDGLQTL VLMNPPTYVQ YSGEQPLPTQ VSSLPGNNLI FLNSVASTSS  60
FPQTSQHLVG IPLPPGSVTG DSNSQSMHHE MSPYHGFASR IHGNLWNPID PAADATGLES  120
TTPRSQQGLS LSLSSQQQRQ PPLPNYGAFR SSERDQVAAA SRPQASAVVS AEDIRLSPGG  180
LSPAASGVTI GVSGMPSAVL SSKYLKAAQE LLDEVVNVGH GIMHKKDKSK KDGEEKKMSG  240
ELTARPKTGD GSASGEGTSR KSGAELTAVE RQEVQMKKAK LMTMLDEVEQ RYRQYHHHMQ  300
VVVASFEQAL GVGSARSYTS LALKTISKQF RCLRDAIAGQ VKAASQSLGE EESSPQGKLQ  360
GTSRLKFVDH HFRQQQALQQ LGMVPHNSNA WRPQRGLPER AVSVLRAWLF EHFLHPYPKD  420
SDKQTLAKQT GLTRSQVSNW FINARVRLWK PMVEEMYLEE TKENEKNESG DKPGKTGHKN  480
NEDSTSKSCP PQNRTPSLST SANSTSPMGG NLGTNTGFSL IGSSELEGIA QVGNKKLRSS  540
QLLQAQAIEV DNKPRDLTNN EPEQLPLAMG FNDERQSRHN YPMLRGPANF IGGFEQYPIE  600
DIGRFGAEQF TAPRFPGNGV SLTLGLPHCE NLSIPGNHHH QNFLHGQSIQ LGRRLEMGDE  660
QHELSGLSSS GPNSSTAFEG MNIQNNRKRF AAQLMPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-150TALE family protein