PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM76083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 172aa    MW: 19811.5 Da    PI: 9.0903
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM76083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-091151492155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp++++++ LA+++gL+++q+ +WF N+R ++
  OWM76083.1 115 KWPYPTEADKKILADSTGLDQKQINNWFINQRKRH 149
                 679*****************************985 PP

2ELK29.22.1e-107090222
         ELK  2 LKhqLlrKYsgyLgsLkqEFs 22
                LK++Ll+K++++++sLk EFs
  OWM76083.1 70 LKDRLLHKFGSHISSLKLEFS 90
                9*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    
MVGEFRHVLL TVVNSRCRFD GIIYACSSST VSPLAILTLD EGFVSSDEEF SGGEVEASLE  60
AQPRSMDRGL KDRLLHKFGS HISSLKLEFS KKKKKGKLPK EARQTLLEWW NVHYKWPYPT  120
EADKKILADS TGLDQKQINN WFINQRKRHW KPSESMQFGL MNNQPGQFYS DD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.19e-53TALE family protein