PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM72429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 338aa    MW: 38129.1 Da    PI: 4.7673
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM72429.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092713042255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +yp++ee+ +L++++gL+++q+ +WF N+R ++
  OWM72429.1 271 WPYPTEEEKLKLSESTGLDQKQINNWFINQRKRH 304
                 58*****************************885 PP

2ELK27.47.5e-10224245122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 E K+ L++KYsg+L+sL+ EF+
  OWM72429.1 224 EMKEILRNKYSGCLSSLRREFL 245
                 56888****************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    
MEDLYRNIVV GSSTVEGFHH HHHQFEGSSA YDNNNNYDDN DNKNELTEEL EGAKVEAAAA  60
AAAESENMSD LIKSQIATHL LYPELVSAYI SCRKVGAPPE IATLLEEIGR VENQRLIMSN  120
CAELGADPQL DEFMESYCEV LHRYKEELSK PFDEATIFLK DIESQLNNLC RDNPTSTLLG  180
SSNSHSHFHS ADEAAGASED EQSCGEAEAP EAQSLGASSR SDREMKEILR NKYSGCLSSL  240
RREFLKKRKN GKLPKDARAA LLEWWNTHYR WPYPTEEEKL KLSESTGLDQ KQINNWFINQ  300
RKRHWKPSED MRFALMEGVG GSMPLYYDTG DGGGHQCT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1240249LRREFLKKRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-81TALE family protein